Copy Link Print Information

IGFBP-1 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGFBP-1 Protein, Canine (HEK293, His)
  • Experimental Validation Results for IGFBP-1 Protein, Canine (HEK293, His)
  • IGFBP-1 Protein, Canine (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Insulin-like growth factor-binding protein 1 (IBP-1), also known as placental protein 12 (PP12), It's a protein encoded by the IGFBP1 gene. Igfbp-1 is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II and circulates in plasma. The binding of the IGFBP-1 protein prolongs the half-life of IGFs and alters their interaction with cell surface receptors. IGFBP-1 can promote cell migration and has the same binding affinity for IGF1 and IGF2. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer[1][2][3].

Verified Bioactivity

Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED 50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-6*His
  • Accession

    A0A8I3NJH1/XP_005629556.1 (T26-S249)

  • Gene ID
    480812  [NCBI]
  • Molecular Construction
    • N-term
    • IGFBP-1 (T26-S249)
      Accession # A0A8I3NJH1/XP_005629556.1
    • His
    • C-term
  • Protein Length

    Full Length of Insulin-like growth factor-binding protein 1 Chain

  • Synonyms

    IGFBP1; Alpha-Pregnancy-Associated Endometrial Globulin; Prev. IBP1; Amniotic Fluid Binding Protein; PP12; Binding Protein-28; Insulin-Like Growth Factor-Binding Protein 1; Binding Protein-26; IGF-Binding Protein 1; Binding Protein-25; Placental Protein 1

  • AA Sequence

    TPQPWHCAPCTPEKLALCPPVPASCAETALPAGCGCCPMCALPQDAPCGVATARCATGLSCRAAPGEERPLHALIRGRGVCVPTDPAADAKESSESSEITQEQLLENFHLMVPSEEDTPILWNAVRNYKTVRSDDSDKLKEPCRRELHEVLARLAEEQASRQLYSFYLPNCNKNGFYHSRQCKTAMDGQRGLCWCVYPWNGERIPGSVEVRGDPNCGQYFTGHS

  • Predicted Molecular Mass

    24.5 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.

  • IGFBP-1 Protein, Canine (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IGFBP-1 Protein, Canine (HEK293, His)
  • Experimental Validation Results for IGFBP-1 Protein, Canine (HEK293, His)
  • IGFBP-1 Protein, Canine (HEK293, His) Product Image