IGFBP-1 Protein, Canine (HEK293, His)

IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

Insulin-like growth factor-binding protein 1 (IBP-1), also known as placental protein 12 (PP12), It's a protein encoded by the IGFBP1 gene. Igfbp-1 is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II and circulates in plasma. The binding of the IGFBP-1 protein prolongs the half-life of IGFs and alters their interaction with cell surface receptors. IGFBP-1 can promote cell migration and has the same binding affinity for IGF1 and IGF2. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer^[1][2][3].

Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED ₅₀ this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×10³ U/mg.

• 
  Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED₅₀ this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×10³ U/mg.

Canine

HEK293

C-6*His

A0A8I3NJH1/XP_005629556.1 (T26-S249)

480812  [NCBI]

Partial

TPQPWHCAPCTPEKLALCPPVPASCAETALPAGCGCCPMCALPQDAPCGVATARCATGLSCRAAPGEERPLHALIRGRGVCVPTDPAADAKESSESSEITQEQLLENFHLMVPSEEDTPILWNAVRNYKTVRSDDSDKLKEPCRRELHEVLARLAEEQASRQLYSFYLPNCNKNGFYHSRQCKTAMDGQRGLCWCVYPWNGERIPGSVEVRGDPNCGQYFTGHS

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.