IGFL2 Protein, Human (HEK293, Fc)

The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFL2 protein, expressed by HEK293 , with N-hFc labeled tag.

IGFL2 Protein emerges as a potential ligand for the IGFLR1 cell membrane receptor, indicating a potential role in mediating cell signaling events. As a putative ligand, IGFL2 is poised to interact with the IGFLR1 receptor on the cell membrane, suggesting involvement in cellular responses and signaling cascades. The identification of IGFL2 as a potential ligand underscores its significance in cell communication and regulatory processes, highlighting the need for further exploration to unravel the specific molecular interactions and functions that IGFL2 may exert in various cellular contexts.

Human

HEK293

N-hFc

Q6UWQ7-1 (P26-P119)

147920  [NCBI]

Full Length of Isoform-1 Mature Protein

PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.