IGFL2 Protein, Human (HEK293, Fc)
The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFL2 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGFL2 protein emerged as a potential ligand for the IGFLR1 cell membrane receptor, suggesting a role in mediating cell signaling events. As a putative ligand, IGFL2 is primed to interact with the IGFLR1 receptor, suggesting involvement in cellular responses and signaling cascades. IGFL2 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFL2 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
IGFL2 Protein emerges as a potential ligand for the IGFLR1 cell membrane receptor, indicating a potential role in mediating cell signaling events. As a putative ligand, IGFL2 is poised to interact with the IGFLR1 receptor on the cell membrane, suggesting involvement in cellular responses and signaling cascades. The identification of IGFL2 as a potential ligand underscores its significance in cell communication and regulatory processes, highlighting the need for further exploration to unravel the specific molecular interactions and functions that IGFL2 may exert in various cellular contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6UWQ7-1 (P26-P119)
-
Molecular Construction
-
N-term
-
hFc
-
IGFL2 (P26-P119)
Accession # Q6UWQ7-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IGFL2; Insulin Growth Factor-Like Family Member 2; IGF Like Family Member 2; VPRI645; UNQ645
-
AA Sequence
PAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
-
Predicted Molecular Mass
38.9 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
