IgG2 Fc Protein, Human (HEK293)
The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG2 Fc Protein, Human (HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293, with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IgG2 Fc protein is the constant region of the immunoglobulin heavy chain and acts as an antigen receptor, triggering the expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG2 Fc Protein, Human (HEK293) is the recombinant human-derived IgG2 Fc protein, expressed by HEK293, with tag free.
Background
The constant region of immunoglobulin heavy chains, referred to as antibodies, comprises membrane-bound or secreted glycoproteins synthesized by B lymphocytes. In the recognition phase of humoral immunity, these membrane-bound immunoglobulins act as receptors, triggering clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells upon binding specific antigens. The effector phase, mediated by secreted immunoglobulins, leads to the elimination of bound antigens. The antigen binding site is shaped by the variable domain of one heavy chain, along with that of its associated light chain, resulting in each immunoglobulin possessing two antigen binding sites with remarkable affinity for a particular antigen. Variable domains undergo V-(D)-J rearrangement and subsequent somatic hypermutations, facilitating affinity maturation for a specific antigen following exposure and selection. Immunoglobulins consist of two identical heavy chains and two identical light chains, interconnected by disulfide linkages.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P01859-1 (E99-K326)
-
Gene ID/
-
Molecular Construction
-
N-term
-
P01859-1 IgG2 Fc (E99-K326)
Accession # -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IGHG2; Immunoglobulin Gamma 2 (Gm Marker); Immunoglobulin Heavy Constant Gamma 2 (G2m Marker); Ig Gamma-2 Chain C Region ZIE; Immunoglobulin Heavy Constant Gamma 2 (Gm Marker); Ig Gamma-2 Chain C Region TIL; Constant Region Of Heavy Chain Of IgG2; Ig Gamm
-
AA Sequence
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
-
Predicted Molecular Mass
25.7 kDa
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
