IgG2C Fc Protein, Mouse (HEK293)
Based on 1 Customer Validation
IgG2C Fc is a subclass of IgG2. Mouse IgG2c Fc loop residues have stronger receptor binding affinity than mouse IgG2b or human IgG1. IgG2C Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2C Fc protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IgG2C Fc is a subclass of IgG2. Mouse IgG2c Fc loop residues have stronger receptor binding affinity than mouse IgG2b or human IgG1. IgG2C Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2C Fc protein, expressed by HEK293 , with tag free.
Background
Antibodies protect pathogens and diseased tissues from invasion through several different mechanisms, including neutralization, antibody-dependent cell-mediated cytotoxicity (ADCC), complement-mediated cytotoxicity, phagocytosis, and phagocytosis. The mouse strains expressed three IgG2 subclasses: IgG2a, 2b and 2c. Mouse IgG2c Fc ring residues promote stronger receptor-binding affinity than mouse IgG2b or human IgG1[1].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
F6TQW2 (I97-S330)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IgG2C Fc (I97-S330)
Accession # F6TQW2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Immunoglobulin heavy constant gamma 2C; Ighg2c
-
AA Sequence
IEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTIS
-
Predicted Molecular Mass
26.1 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
