IgG3 Fc Protein, Human (Biotinylated, HEK293, Avi)
Based on 1 Customer Validation
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Verified Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Human CD64, His Tag at 5 μg/mL (100 μL/well) can bind Biotinylated Human IgG3 Fc Protein, Avitag.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi
-
Accession
P01860-1 (E99-K377)
-
Gene ID3502
-
Molecular Construction
-
N-term
-
Avi
-
IgG3 Fc (E99-K377)
Accession # P01860-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
IGHG3; Secrete-Type Ig Gamma Heavy-Chain; Immunoglobulin Heavy Constant Gamma 3 (G3m Marker); Heavy Chain Disease Protein; Immunoglobulin Heavy Constant Gamma 3 (Gm Marker); Ig Gamma-3 Chain C Region; Constant Region Of Heavy Chain Of IgG3; C Gamma 3; Imm
-
AA Sequence
ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
-
Predicted Molecular Mass
33.4 kDa
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)