IgG3 Fc Protein, Mouse (230a.a, HEK293)

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation. IgG3 Fc Protein, Mouse (230a.a, HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation[1][2]. IgG3 Fc Protein, Mouse (230a.a, HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293, with tag free.

Background

Human IgG consists of four subclasses: IgG1, IgG2, IgG3 and IgG4. In four subclasses, IgG3 has a relative high affinity towards each human Fcγ receptor (FcγRI, FcγRIIA/B/C, FcγRIIIA/B) and higher complement activation capacity[2]. IgG3 Fc protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Human IgG3 Fc protein only shares about 68% aa sequence identity with mouse IgG3 Fc protein.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IgG3 Fc (P98-P327)
      Accession # P03987-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IGHG3; Secrete-Type Ig Gamma Heavy-Chain; Immunoglobulin Heavy Constant Gamma 3 (G3m Marker); Heavy Chain Disease Protein; Immunoglobulin Heavy Constant Gamma 3 (Gm Marker); Ig Gamma-3 Chain C Region; Constant Region Of Heavy Chain Of IgG3; C Gamma 3; Imm

  • AA Sequence

    PRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSP

  • Predicted Molecular Mass

    26.1 kDa

  • Molecular Weight

    Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00