IgG3 Fc Protein, Mouse (230a.a, HEK293)
IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation. IgG3 Fc Protein, Mouse (230a.a, HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293, with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation[1][2]. IgG3 Fc Protein, Mouse (230a.a, HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293, with tag free.
Background
Human IgG consists of four subclasses: IgG1, IgG2, IgG3 and IgG4. In four subclasses, IgG3 has a relative high affinity towards each human Fcγ receptor (FcγRI, FcγRIIA/B/C, FcγRIIIA/B) and higher complement activation capacity[2]. IgG3 Fc protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Human IgG3 Fc protein only shares about 68% aa sequence identity with mouse IgG3 Fc protein.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
P03987-2 (P98-P327)
-
Gene ID380795
-
Molecular Construction
-
N-term
-
IgG3 Fc (P98-P327)
Accession # P03987-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IGHG3; Secrete-Type Ig Gamma Heavy-Chain; Immunoglobulin Heavy Constant Gamma 3 (G3m Marker); Heavy Chain Disease Protein; Immunoglobulin Heavy Constant Gamma 3 (Gm Marker); Ig Gamma-3 Chain C Region; Constant Region Of Heavy Chain Of IgG3; C Gamma 3; Imm
-
AA Sequence
PRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSP
-
Predicted Molecular Mass
26.1 kDa
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
