IL-1 beta Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)

IL-1 beta Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-1 beta protein, expressed by HEK293, with C-His & Avi tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-1 beta Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-1 beta protein, expressed by HEK293, with C-His & Avi tag.

Background

IL-1 beta Protein is a potent pro-inflammatory cytokine initially discovered as a major endogenous pyrogen. It induces prostaglandin synthesis, neutrophil activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. IL-1 beta Protein also promotes Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis from Th1 cells. Additionally, it plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His;Avi
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Synonyms

    IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1

  • AA Sequence

    APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAESMPVFLGGTRGGQDITDFTMQFVS

  • Predicted Molecular Mass

    21.3 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00