Copy Link Print Information

IL-17F Protein, Rat (sf9, His)

Customer Review

Based on 1 Customer Validation

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer. IL-17F Protein, Rat (sf9, His) is a recombinant rat IL-17F protein with His tag at the C-terminus and is expressed in sf9 insect cells. It consists of 153 amino acids (M1-A153).

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IL-17F Protein, Rat (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][2]. IL-17F Protein, Rat (sf9, His) is a recombinant rat IL-17F protein with His tag at the C-terminus and is expressed in sf9 insect cells. It consists of 153 amino acids (M1-A153).

Background

Interleukin-17F (IL-17F) belongs to the IL-17 cytokine family. IL-17F is expressed in activated CD4 T cells, activated monocytes, basophils and mast cells. IL-17F can be produced by differentiated TH17 cells, lamina propria T cells, memory CD4+ T cells, γδ T cells and NKT cells[1].
The rat IL-17F shares 57.14% amino acid sequence identity with human and 86.34% identity with mouse.
IL-17F is an inflammatory cytokine that induces many proinflammatory cytokines and chemokines, including TGF-β, IL-2, ICAM1, GM-CSF, CCL2, CCL7, TSLP, MMP13, IL-6 and CXCL1. IL-17F also induces antimicrobial peptides including hBD-2, S100A7, S100A8 and S100A9 with IL-22 and can synergize with IL-23 in human eosinophils to promote the production of IL-1β and IL-6. IL-17F is a homodimeric cytokine. IL-17F shares the most similarities with IL-17A (50% homology) and can be produced as an IL-17AF heterodimer. IL-17A, IL-17F and IL-17A/F use the same receptor complex: IL-17RA and IL-17RC heterodimer. They trigger qualitatively similar signaling pathways, and IL-17F exhibits the lowest biological activity. IL-17F shows about 100–1000 times lower affinity to the IL-17RA subunit than IL-17A, and does not compete with IL-17A binding to IL-17RA[1][2].
IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][3][4].

In Vivo

IL-17F (1 ng/mL; -24 h) up-regulates the expression of Cav-1 and p-Cav-1 in a time-dependent manner in rat pulmonary microvascular endothelial cells (PMVECs)[5].
IL-17F (2-1 ng/mL; 1-5 days) increases rat osteoblasts proliferation in a dose- and time-dependent manner[6].

Verified Bioactivity

1. Measured by its binding ability in a functional ELISA.
2. Immobilized rat IL17F-His at 10 μg/mL (100 μL/well) can bind Rat IL17RA-Fc3. The EC50 of Rat IL17RA-Fc3 is 0.28-0.66 μg/mL.

Technical Parameters

  • Species Rat
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    Q5BJ95 (A28-A161)

  • Gene ID
    301291  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17F (A28-A161)
      Accession # Q5BJ95
    • His
    • C-term
  • Protein Length

    Full Length of Interleukin-17F Chain

  • Synonyms

    IL17F; ML1; Interleukin 17F; Interleukin-17F; IL-17F; Cytokine ML-1; ML-1; CANDF6

  • AA Sequence

    ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46(1):7-11. [Content Brief]

[2]. McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50(4):892-906. [Content Brief]

[3]. Ferreira N, et al. IL-17A and IL-17F orchestrate macrophages to promote lung cancer. Cell Oncol (Dordr). 2020 Aug;43(4):643-654. [Content Brief]

[4]. Tong Z, et al. A protective role by interleukin-17F in colon tumorigenesis. PLoS One. 2012;7(4):e34959. [Content Brief]

[5]. Gao X, et al. [Effects of IL-17F/IL-17RC on the expression of caveolae-1 in rat pulmonary microvascular endothelial cells]. Zhonghua Yi Xue Za Zhi. 2015 Mar 31;95(12):938-42. [Content Brief]

[6]. Zhang N, et al. IL-17F promotes osteoblastic osteogenesis via the MAPK/ERK1/2 signaling pathway. Exp Ther Med. 2021 Oct;22(4):1052. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IL-17F Protein, Rat (sf9, His) Product Image
    1/16
  • IL-17F Protein, Rat (sf9, His) Product Image