IL-19 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (HEK293, His) is the recombinant human-derived IL-19 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (HEK293, His) is the recombinant human-derived IL-19 protein, expressed by HEK293 , with C-His labeled tag.
Background
The IL-19 Protein serves a dual role as an anti-inflammatory and proangiogenic factor. It plays a crucial role in shaping adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses, achieved through the down-regulation of IFN-gamma and the up-regulation of IL4 and IL13. Produced by osteocytes, IL-19 also contributes to granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex comprising the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, particularly emphasizing STAT3 activation, highlighting its pivotal role in diverse immunomodulatory functions.
Verified Bioactivity
Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL20 Rα and human IL20 Rβ. The ED50 for this effect is typically 4.1ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9UHD0-1 (L25-A177)
-
Molecular Construction
-
N-term
-
IL-19 (L25-A177)
Accession # Q9UHD0-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL19; IL-19; Interleukin 19; MDA1; ZMDA1; Melanoma Differentiation Associated Protein-Like Protein; NG.1; Interleukin-19; IL-10C; Melanoma Differentiation-Associated Protein-Like Protein
-
AA Sequence
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
-
Predicted Molecular Mass
19.2 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
