IL-19 Protein, Human (HEK293, His)

IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (HEK293, His) is the recombinant human-derived IL-19 protein, expressed by HEK293 , with C-His labeled tag.

The IL-19 Protein serves a dual role as an anti-inflammatory and proangiogenic factor. It plays a crucial role in shaping adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses, achieved through the down-regulation of IFN-gamma and the up-regulation of IL4 and IL13. Produced by osteocytes, IL-19 also contributes to granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex comprising the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, particularly emphasizing STAT3 activation, highlighting its pivotal role in diverse immunomodulatory functions.

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL20 Rα and human IL20 Rβ. The ED₅₀ for this effect is typically 4.1ng/mL.

Human

HEK293

C-His

Q9UHD0-1 (L25-A177)

29949  [NCBI]

Full Length of Isoform-1 Mature Protein

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.