Copy Link Print Information

IL-1RA/IL-1F3 Protein, Porcine

Customer Review

Based on 1 Customer Validation

IL-1RA/IL-1F3 proteins are powerful anti-inflammatory antagonists in the interleukin 1 family, specifically targeting the pro-inflammatory cytokines IL1B and IL1A. This protein counteracts the inflammatory effects of IL1, playing a critical role in preventing immune dysregulation and preventing uncontrolled systemic inflammation triggered by a variety of innate irritants, including pathogens. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Porcine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-1RA/IL-1F3 Protein, Porcine
  • Experimental Validation Results for IL-1RA/IL-1F3 Protein, Porcine
  • IL-1RA/IL-1F3 Protein, Porcine Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-1RA/IL-1F3 proteins are powerful anti-inflammatory antagonists in the interleukin 1 family, specifically targeting the pro-inflammatory cytokines IL1B and IL1A. This protein counteracts the inflammatory effects of IL1, playing a critical role in preventing immune dysregulation and preventing uncontrolled systemic inflammation triggered by a variety of innate irritants, including pathogens. IL-1RA/IL-1F3 Protein, Porcine is the recombinant Porcine-derived IL-1RA/IL-1F3 protein, expressed by E. coli , with tag free.

Background

The IL-1RA/IL-1F3 protein serves as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. With its ability to counteract the inflammatory effects of IL1, this protein plays a crucial role in protecting against immune dysregulation and preventing uncontrolled systemic inflammation induced by a variety of innate stimulatory agents, including pathogens. By acting as a regulatory shield against IL1-mediated responses, IL-1RA/IL-1F3 contributes significantly to maintaining immune balance and curtailing excessive inflammatory reactions.

Verified Bioactivity

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×10^4 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×104 units/mg.

Technical Parameters

  • Species Porcine
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q29056 (H26-Q177)

  • Gene ID
    397499  [NCBI]
  • Molecular Construction
    • N-term
    • IL-1RA (H26-Q177)
      Accession # Q29056
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R

  • AA Sequence

    HPLGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPVEPHFVFLGIHGGKLCLSCVKSGDEMKLQLDAVNITDLRKNSEQDKRFTFIRSDSGPTTSFESAACPGWFLCTALEADQPVGLTNTPKAAVKVTKFYFQQDQ

  • Predicted Molecular Mass

    17.1 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.03295 μg/mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 4.18×104 units/mg.

  • IL-1RA/IL-1F3 Protein, Porcine Product Image
    1/16
  • Experimental Validation Results for IL-1RA/IL-1F3 Protein, Porcine
  • Experimental Validation Results for IL-1RA/IL-1F3 Protein, Porcine
  • IL-1RA/IL-1F3 Protein, Porcine Product Image