IL-20 Protein, Human (HEK293, His)

IL-20 protein is a proinflammatory cytokine secreted by monocytes and keratinocytes that is critical for immune responses, inflammation, hematopoiesis, and epidermal cell differentiation. It plays a key role in tissue remodeling, wound healing, and maintenance of epithelial homeostasis during infection. IL-20 Protein, Human (HEK293, His) is the recombinant human-derived IL-20 protein, expressed by HEK293, with N-His labeled tag.

IL-20 Protein, a pro-inflammatory and angiogenic cytokine predominantly secreted by monocytes and skin keratinocytes, assumes critical roles in immune responses, inflammatory regulation, hemopoiesis, and the differentiation of epidermal cells and keratinocytes. It plays a pivotal part in tissue remodeling and wound-healing processes, contributing to the restoration of epithelial layer homeostasis during infections and inflammatory responses, thereby maintaining tissue integrity. Notably, IL-20 impacts various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are mediated through the type I IL-20 receptor complex, comprising IL20RA and IL20RB, or, alternatively, through the type II IL-20 receptor complex, consisting of IL22RA1 and IL20RB. Functioning as an arteriogenic and vascular remodeling agent, IL-20 activates diverse signaling processes, including the phosphorylation of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. Additionally, it forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Human

HEK293

N-His

Q9NYY1-1 (L25-E176)

50604

Full Length of Isoform-1 Mature Protein

LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.