IL-22 Protein, Cynomolgus (HEK293, His)

The IL-22 protein is a member of the IL-10 family and is notable for its differences. This important cytokine plays a central role in immune response and inflammation. IL-22 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-22 protein, expressed by HEK293 , with C-His labeled tag.

IL-22 Protein belongs to the IL-10 family and is recognized for its significant divergence from other family members. This protein functions as a vital cytokine involved in numerous immune responses and inflammatory processes. IL-22 plays a crucial role in promoting the activation and recruitment of immune cells, including T-helper 2 (Th2) cells, mast cells, and eosinophils, to sites of inflammation. It is primarily secreted by epithelial and endothelial cells and exerts its effects through the IL-22 receptor. Upon binding, IL-22 stimulates the production of various pro-inflammatory cytokines and chemokines. Notably, IL-22 has been implicated in a wide range of diseases, such as asthma, allergic diseases, and autoimmune disorders, underscoring its significance as a potential therapeutic target for modulating immune responses.

Immobilized Cynomolgus IL-22, His Tag at 5 μg/ml (100μl/well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC₅₀ of 0.16 μg/ml determined by ELISA.

Cynomolgus

HEK293

C-8*His

G7PHZ7 (A34-I179)

102129310  [NCBI]

Full Length of Mature Protein

APVSSHCRLDKSNFQQPYITNRTFMLAKEASSADNNTDVRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVPFLARLSNSLSTCHIEGDDLHIQKNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.