IL-22 Protein, Mouse (His-Avi)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (His-Avi) is the recombinant mouse-derived IL-22 protein, expressed by E. coli , with N-His, N-Avi labeled tag.

IL-22 is a secreted IL-10 family cytokine that plays a critical role in modulating tissue responses during inflammation, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells^[1][2][3][4].
IL-22 is produced by several T cells, ILC3, neutrophils and macrophages, IL-22 has a specific receptor which is composed of IL-22R1 and IL-10R2, presenting on non-immune cells in many organs. Ligation of IL22RA1 with IL22 induces activation of the tyrosine kinases JAK1 and TYK2, which activates STAT3, and p38 MAPK, in turn, promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 promotes phosphorylation of GSK3B at 'Ser-9' and CTTN as well^[5].
IL-22 gets positive regulation from IL-23, IL-1β, IL-7, AhR and Notch, IL-22 gets negative regulation from IL-22BP, TGF-β, IL-27, ICOS, c-Maf and IL-25^[6].

Mouse

E. coli

N-Avi;N-8*His

Q9JJY9 (L34-V179)

50929  [NCBI]

Full Length of Mature Protein

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Saxton RA, et al. The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design. Immunity. 2021 Apr 13;54(4):660-672.e9.  [Content Brief]

  [2]. Delbue D, et al. Reprogramming Intestinal Epithelial Cell Polarity by Interleukin-22. Front Med (Lausanne). 2021 Apr 12;8:656047.  [Content Brief]

  [3]. Weathington NM, et al. Glycogen synthase kinase-3β stabilizes the interleukin (IL)-22 receptor from proteasomal degradation in murine lung epithelia. J Biol Chem. 2014 Jun 20;289(25):17610-9.  [Content Brief]

  [4]. Wei CC, et al. Cloning and characterization of mouse IL-22 binding protein. Genes Immun. 2003 Apr;4(3):204-11.  [Content Brief]

  [5]. Dudakov JA, et al. Interleukin-22: immunobiology and pathology. Annu Rev Immunol. 2015;33:747-85.  [Content Brief]