IL-2R beta/CD122 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately). IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells. IL-2R beta/CD122 Protein, Canine (HEK293, His) is a recombinant canine IL-2R betawith a C-Terminal His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Canine (HEK293, His) is a recombinant canine IL-2R betawith a C-Terminal His tag, which is produced in HEK293 cells.

Background

IL-2R beta (CD122) is a type I cytokine receptor, and belongs to Type 4 subfamily. IL-2R beta is also a key component of the IL-15 receptor. IL-2R beta is broadly expressed in spleen, blood, and lymph node, such as B and T lymphocytes[1][3].
The sequence of amino acids in IL-2R beta differs in different species.
IL-2R beta cytoplasmic domain heterodimerizes with IL-2 and leads to the activation of signaling pathways: phosphoinositol 3-kinase (PI3-K)/AKT, Ras-MAP kinase, and the JAK-STAT pathways[4]. IL-2R beta binds IL-2 with intermediate affinity. IL-2R beta mediates IL-2 internalization and signal transduction, such as cell proliferation or differentiation[5]. IL-2R beta interacts with IL-2 and increases the proportion of CD4+ T lymphocytes[1]. IL-2R stimulates T cell proliferation and activating lymphokine-activated killer cells[2].
IL-2R beta mediates T cell immune responses, and also mediates endocytosis, as well as transducing the mitogenic signals of IL-2.

Verified Bioactivity

Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.4095 μg/mL in the presence of 4 ng/mL of recombinant human IL-15, corresponding to a specific activity is 2.44×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.4095 μg/mL in the presence of 4 ng/mL of recombinant human IL-15, corresponding to a specific activity is 2.44×103 units/mg.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    IL2RB; Interleukin 2 Receptor, Beta; Prev. IL15RB; IL-2R Subunit Beta; High Affinity IL-2 Receptor Subunit Beta; CD122 Antigen; Interleukin-2 Receptor Subunit Beta; IL-2RB; P70-75; P75; CD122; High Affinity IL-2 Receptor Beta Subunit; Interleukin-15 Recep

  • AA Sequence

    NADTSKLTCFYNSKANISCIWSWDGDLQATSCKIHAQPDRRPWNKSCELLPMRPAFWACYLILGSPDAQSLTSADVVGMSVMCHEGERWRILMTQDFKPFENLRLMAPNGLQVADVGTHKCNITWKVPQSSHYIKRYLEFEARKRSPGHSWEEASLMALRQNQQWISLETLTPDTLYEFQVRVRAQRGSHKTWSPWSQPLAFRTRPAARGKQSLPFP

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00