1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-2 Receptor
  5. IL-2R gamma/Common gamma-Chain/CD132
  6. IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)

IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77591
Handling Instructions Technical Support

IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-2R gamma/CD132 protein serves as a common subunit for receptors of various interleukins, including IL2, IL4, IL7, IL15, IL21, and likely IL13. Likely in association with IL15RA, it plays a role in stimulating neutrophil phagocytosis by IL15. The gamma subunit, essential for diverse interleukin receptor complexes, interacts with SHB upon interleukin stimulation and also engages with IL9. Through these interactions, IL-2R gamma/CD132 contributes to the intricate network of signaling events associated with interleukin-mediated immune responses, highlighting its central role in immune modulation and cellular activities.

Biological Activity

Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e cells. The ED50 for this effect is 1.410 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2 , corresponding to a specific activity is 709.2199 units/mg.

  • Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e cells. The ED50 for this effect is 1.410 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2 , corresponding to a specific activity is 709.2199 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

Q38JL2 (L23-N254)

Gene ID
Molecular Construction
N-term
IL-2R gamma/CD132 (L23-N254)
Accession # Q38JL2
6*His
C-term
Protein Length

Partial

Synonyms
CD132; CIDX; IL-2 R gamma; IL2RG; IMD4; P64; SCIDX; SCIDX1; gammaC
AA Sequence

LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKEN

Molecular Weight

50-68 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77591
Quantity:
MCE Japan Authorized Agent: