Copy Link Print Information

IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)
  • IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-2R gamma/CD132 protein serves as a common subunit for receptors of various interleukins, including IL2, IL4, IL7, IL15, IL21, and likely IL13. Likely in association with IL15RA, it plays a role in stimulating neutrophil phagocytosis by IL15. The gamma subunit, essential for diverse interleukin receptor complexes, interacts with SHB upon interleukin stimulation and also engages with IL9. Through these interactions, IL-2R gamma/CD132 contributes to the intricate network of signaling events associated with interleukin-mediated immune responses, highlighting its central role in immune modulation and cellular activities.

Verified Bioactivity

Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e cells. The ED50 for this effect is 1.410 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2 , corresponding to a specific activity is 709.2199 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e cells. The ED50 for this effect is 1.410 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2 , corresponding to a specific activity is 709.2199 units/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q38JL2 (L23-N254)

  • Gene ID
    641338  [NCBI]
  • Molecular Construction
    • N-term
    • IL-2R gamma/CD132 (L23-N254)
      Accession # Q38JL2
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL2RG; IL-2 Receptor Subunit Gamma; Prev. SCIDX1; CD132 Antigen; Prev. CIDX; IL-2RG; Prev. IMD4; Common Cytokine Receptor Gamma Chain; Cytokine Receptor Common Subunit Gamma; Combined Immunodeficiency, X-Linked; GammaC; Severe Combined Immunodeficiency; C

  • AA Sequence

    LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKEN

  • Predicted Molecular Mass

    28.2 kDa

  • Molecular Weight

    Approximately 50-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e cells. The ED50 for this effect is 1.410 µg/mL in the presence of 30 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2 , corresponding to a specific activity is 709.2199 units/mg.

  • IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His)
  • IL-2R gamma/CD132 Protein, Cynomolgus (HEK293, His) Product Image