IL-2R gamma/CD132 Protein, Human (HEK293, hFc)
IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Human (HEK293, hFc) is the recombinant human-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Human (HEK293, hFc) is the recombinant human-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
IL-2R gamma/CD132 protein serves as a common subunit for receptors of various interleukins, including IL2, IL4, IL7, IL15, IL21, and likely IL13. Likely in association with IL15RA, it plays a role in stimulating neutrophil phagocytosis by IL15. The gamma subunit, essential for diverse interleukin receptor complexes, interacts with SHB upon interleukin stimulation and also engages with IL9. Through these interactions, IL-2R gamma/CD132 contributes to the intricate network of signaling events associated with interleukin-mediated immune responses, highlighting its central role in immune modulation and cellular activities.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P31785-1 (L23-N254)
-
Molecular Construction
-
N-term
-
IL-2R gamma/CD132 (L23-N254)
Accession # P31785-1 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IL2RG; IL-2 Receptor Subunit Gamma; Prev. SCIDX1; CD132 Antigen; Prev. CIDX; IL-2RG; Prev. IMD4; Common Cytokine Receptor Gamma Chain; Cytokine Receptor Common Subunit Gamma; Combined Immunodeficiency, X-Linked; GammaC; Severe Combined Immunodeficiency; C
-
AA Sequence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
-
Predicted Molecular Mass
54.1 kDa
-
Molecular Weight
Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
