IL-2R gamma/CD132 Protein, Human (HEK293, hFc)

IL-2R gamma/CD132 Protein, a common subunit for interleukin receptors, likely collaborates with IL15RA in stimulating neutrophil phagocytosis by IL15. It is shared among IL2, IL4, IL7, IL15, IL21, and possibly IL13 receptors. IL-2R gamma interacts with SHB upon interleukin stimulation and also interacts with IL9. IL-2R gamma/CD132 Protein, Human (HEK293, hFc) is the recombinant human-derived IL-2R gamma/CD132 protein, expressed by HEK293 , with C-hFc labeled tag.

IL-2R gamma/CD132 protein serves as a common subunit for receptors of various interleukins, including IL2, IL4, IL7, IL15, IL21, and likely IL13. Likely in association with IL15RA, it plays a role in stimulating neutrophil phagocytosis by IL15. The gamma subunit, essential for diverse interleukin receptor complexes, interacts with SHB upon interleukin stimulation and also engages with IL9. Through these interactions, IL-2R gamma/CD132 contributes to the intricate network of signaling events associated with interleukin-mediated immune responses, highlighting its central role in immune modulation and cellular activities.

Human

HEK293

C-hFc

P31785-1 (L23-N254)

3561  [NCBI]

Partial

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Approximately 70-100 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.