1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-2 Receptor
  5. IL-2R gamma/Common gamma-Chain/CD132
  6. IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi)

IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P78401
Handling Instructions Technical Support

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types. IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi) is a recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2[1]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi) is a recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.

Background

IL-2R gamma (CD132), a receptor for IL-2, is a member of the type I cytokine receptor family and type 5 subfamily. IL-2R gamma is expressed in leucocyte subsets and human monocytes[1][3]. Human IL-2R gamma consists of extracellular domain (L23-A262), helical domain (V263-L283), and cytoplasmic domain (E284-T369).
The sequence of amino acids in IL-2R beta differs in different species. Human IL-2R gamma shares <75% aa sequence identity with mouse and rats.
IL-2R gamma has low-affinity for IL-2, but has intermediate affinity for IL-2 when forming heterodimer with IL-2R beta. IL-2R beta/gama heterodimer complex transduces a signal when IL-2 concentrations are relatively high[1]. IL-2R gamma can be utilized by the IL-2, IL-4, IL-7, IL-9, and IL-15 receptor, and takes part in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma is tightly up-regulated by IL-2 and IFN gamma[3]. Mutations of L-2R gamm cause human X-linked severe combined immunodeficiency (XSCID)[4].
IL-2R gamma is involved in inflammatory response, and mediates activation of the cells[1].

In Vitro

IL-2R gamma (human) migrates with a molecular weight corresponding to 55–60 kDa (immunoblotting of lysates prepared from Sf9 cells infected with VL1392-hIL-2Rγ)[5].
IL-2R gamma binds to IL-2 in recombinant IL-2R gamma plasmid (pGEX-4T-1-IL-2Rγ)-transfected 293T cells[6].

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P31785-1 (L23-N254)

Gene ID
Molecular Construction
N-term
IL-2R gamma/CD132 (L23-N254)
Accession # P31785-1
8*His-Avi
C-term
Protein Length

Partial

Synonyms
CD132; CIDX; IL-2 R gamma; IL2RG; IMD4; P64; SCIDX; SCIDX1; gammaC
AA Sequence

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Predicted Molecular Mass
39.9 kDa
분자량

Approximately 58-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-2R gamma/CD132 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78401
수량:
MCE Japan Authorized Agent: