IL-3 Protein, Human (His-Avi)
Based on 1 Customer Validation
IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His-Avi) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-His, N-Avi labeled tag.
- Species: Human
- Source: E. coli
-
Almacenamiento:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Technical Parameters
-
Product Properties
- Documentación
- Help & FAQs
Actividad biológica
IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His-Avi) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-His, N-Avi labeled tag.
The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Additionally, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival. Moreover, it participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal transducing subunit IL3RB. Stimulation of this receptor leads to the rapid activation of JAK2 kinase activity, initiating a STAT5-mediated transcriptional program. Alternatively, IL-3 contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK. The cytokine also interacts with IL3RA to modulate its diverse physiological effects.
Immobilized Human IL-3 His at 5 μg/mL (100 μL/Well) on the plate. Dose response curve for Human IL-3 R alpha hFc with the EC50 < 0.61 μg/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi;N-6*His
-
Accession
P08700 (A20-F152)
-
Molecular Construction
-
N-term
-
6*His-Avi
-
IL-3 (A20-F152)
Accession # P08700 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I
-
AA Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
-
Predicted Molecular Mass
16.9 kDa
-
Peso molecular
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Pureza
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentación
-
Ficha de datos (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Instrucciones de manejo (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
