IL-33 Protein, Canine

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Background

IL-33 Protein is a cytokine that binds to and activates the IL1RL1/ST2 receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells. It plays a role in the maturation of Th2 cells and induces the secretion of T-helper type 2-associated cytokines. IL-33 is also involved in the activation of mast cells, basophils, eosinophils, and natural killer cells. It acts as a chemoattractant for Th2 cells and may function as an 'alarmin', amplifying immune responses during tissue injury. Additionally, IL-33 induces rapid mitochondrial rewiring via UCP2, reducing the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the production of itaconate and subsequent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelial cells, IL-33 is constitutively and abundantly expressed in its uncleaved form, acting as a chromatin-associated nuclear factor with transcriptional repressor properties and sequestering nuclear NF-kappaB/RELA, resulting in lower expression of its target genes. However, this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized IL-33 Protein, Canine at 10 μg/mL (100 μL/well) can bind human IL1R4-Fc and the EC50 is 0.25-0.66 μg/mL.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Met
    • IL-33 (S110-S263)
      Accession # O97863
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33

  • AA Sequence

    SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

  • Predicted Molecular Mass

    17.8 kDa

  • Molecular Weight

    Approximately 19kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00