IL-33 Protein, Canine
Based on 1 publication(s) in Google Scholar
IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.
Background
IL-33 Protein is a cytokine that binds to and activates the IL1RL1/ST2 receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells. It plays a role in the maturation of Th2 cells and induces the secretion of T-helper type 2-associated cytokines. IL-33 is also involved in the activation of mast cells, basophils, eosinophils, and natural killer cells. It acts as a chemoattractant for Th2 cells and may function as an 'alarmin', amplifying immune responses during tissue injury. Additionally, IL-33 induces rapid mitochondrial rewiring via UCP2, reducing the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the production of itaconate and subsequent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelial cells, IL-33 is constitutively and abundantly expressed in its uncleaved form, acting as a chromatin-associated nuclear factor with transcriptional repressor properties and sequestering nuclear NF-kappaB/RELA, resulting in lower expression of its target genes. However, this form is rapidly lost upon angiogenic or pro-inflammatory activation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized IL-33 Protein, Canine at 10 μg/mL (100 μL/well) can bind human IL1R4-Fc and the EC50 is 0.25-0.66 μg/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Arch Biochem Biophys
PACAP/PAC1R activation promotes group 2 innate lymphoid cells-dependent allergic rhinitis via ERK pathway. [Abstract]2025 Oct:772:110564. PMID: 40713003
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
O97863 (S110-S263)
-
Molecular Construction
-
N-term
-
Met
-
IL-33 (S110-S263)
Accession # O97863 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33
-
AA Sequence
SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 19kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)