IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)

Customer Review

Based on 1 Customer Validation

IL-6 is a cytokine with multiple functions in immunity, tissue regeneration, and metabolism, coordinating complex signaling. Binding to IL6R initiates the IL6 signaling pathway through a complex with the signaling subunit IL6ST/gp130. IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-6 protein, expressed by HEK293, with N-His and N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-6 is a cytokine with multiple functions in immunity, tissue regeneration, and metabolism, coordinating complex signaling. Binding to IL6R initiates the IL6 signaling pathway through a complex with the signaling subunit IL6ST/gp130. IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-6 protein, expressed by HEK293, with N-His and N-Avi labeled tag.

Background

IL-6, a cytokine boasting a diverse array of biological functions spanning immunity, tissue regeneration, and metabolism, engages in a sophisticated signaling orchestration. Upon binding to IL6R, the resulting complex orchestrates the intracellular IL6-signaling pathway through its association with the signaling subunit IL6ST/gp130. Interactions with membrane-bound IL6R and IL6ST prompt 'classic signaling,' whereas binding of IL6 to soluble IL6R and IL6ST elicits 'trans-signaling.' Furthermore, 'cluster signaling' unfolds as membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on adjacent receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly contributing to host defense during infection and tissue injury, yet its overproduction is implicated in disease pathology. In the innate immune response, IL-6 synthesis by myeloid cells, including macrophages and dendritic cells, is triggered upon pathogen recognition through toll-like receptors (TLRs) at the infection or injury site. Crucially, in the adaptive immune response, IL-6 is indispensable for the differentiation of B cells into immunoglobulin-secreting cells, a pivotal player in the differentiation of CD4(+) T cell subsets, and a key factor in the development of T follicular helper (Tfh) cells crucial for germinal-center induction. Additionally, IL-6 is required to drive naive CD4(+) T cells toward the Th17 lineage and plays a crucial role in the proliferation of myeloma cells and the survival of plasmablast cells.

Verified Bioactivity

Immobilized Human IL-6 R alpha, hFc Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Cynomolgus IL-6, His-Avi Tag with the EC50 of 0.1-1.0 μg/mL determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-Avi;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • Avi
    • IL-6 (A28-M212)
      Accession # P79341
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ

  • AA Sequence

    APVLPGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

  • Predicted Molecular Mass

    23.9 kDa

  • Molecular Weight

    Approximately 27-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00