IL-6 Protein, Equine

IL-6 protein is a crucial cytokine in immunity, tissue regeneration and metabolism. It binds to IL6R and forms a complex that binds to IL6ST/gp130, triggering intracellular IL6 signaling. Membrane-bound IL6:IL6R complexes induce "cluster signaling" that activates IL6ST receptors on neighboring cells. IL-6 Protein, Equine is the recombinant equine-derived IL-6 protein, expressed by E. coli , with tag free.

IL-6, a multifunctional cytokine, exerts diverse biological effects in immunity, tissue regeneration, and metabolism. Upon binding to its receptor, IL6R, the complex associates with the signaling subunit IL6ST/gp130, initiating the intracellular IL6-signaling pathway. This interaction can elicit 'classic signaling' when IL6 binds to membrane-bound IL6R, or 'trans-signaling' when IL6 and soluble IL6R engage IL6ST. Additionally, 'cluster signaling' occurs when IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 is a crucial inducer of the acute phase response, rapidly produced during infection and tissue injury for host defense. However, excessive IL-6 synthesis is implicated in various disease pathologies. In the innate immune response, myeloid cells, including macrophages and dendritic cells, synthesize IL-6 upon recognizing pathogens through toll-like receptors (TLRs) at infection sites or tissue injuries. In the adaptive immune response, IL-6 is essential for B cell differentiation into immunoglobulin-secreting cells, T follicular helper (Tfh) cell development, and driving naive CD4(+) T cells toward the Th17 lineage. Furthermore, IL-6 plays a significant role in myeloma cell proliferation and the survival of plasmablast cells.

Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is 0.6786 ng/mL, corresponding to a specific activity is 1.474×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is 0.6786 ng/mL, corresponding to a specific activity is 1.474×10⁶ units/mg.

Equine

E. coli

Tag Free

Q95181 (F26-M208)

100034196  [NCBI]

Partial

FPTPLPLGEDETTSNGPLLTTADKTKQHIKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNPEVTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.