IL-7 Protein, Rat (His)

IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects. IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E. coli , with His tagged. .

IL-7 Protein is a crucial hematopoietic cytokine that regulates the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby controlling the population of mature lymphocytes and ensuring lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors plays a significant role in mediating these effects.

Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ for this effect is 0.5105 ng/mL, corresponding to a specific activity is 1.959×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ for this effect is 0.5105 ng/mL, corresponding to a specific activity is 1.959×10⁶ units/mg.

Rat

E. coli

N-6*His

NP_037242 (D26-I154)

25647

Full Length of Mature Protein

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.