IL-9R Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.
Background
Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. Interleukin 9 receptor enables interleukin-9 binding activity and interleukin-9 receptor activity. Interleukin 9 receptor is involved in positive regulation of cell growth and located in cell surface and plasma membrane[1][2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
G3V8S1 (M1-A270)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IL-9R (M1-A270)
Accession # G3V8S1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL9R; IL-9 Receptor; Interleukin 9 Receptor; IL-9R; CD129; CD129 Antigen; Interleukin-9 Receptor; IL9R Protein
-
AA Sequence
MALGRCFPEGCTVEGAAVKQVSWFLIYSCVCSCVCWGVSVPAQEGGRKAGTFTCFSNSVFRIDCHWSAPEPGSRAWLLFTSNQVTDIKHKCTFWDSRCTLVLPKEEAFLPFDNFTITLHRCVMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISFGLEPLITSLSYELAFKRQEEAWEQARLKDRIVGVTWLVLEAIELNPDTIYEARLRVQMALESYDDKTEGEYYKSHWSEWSQSVSFPSPRRKTQGLLIPRWQGSA
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
