IL-9R Protein, Rat (HEK293, His)

Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.

Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. Interleukin 9 receptor enables interleukin-9 binding activity and interleukin-9 receptor activity. Interleukin 9 receptor is involved in positive regulation of cell growth and located in cell surface and plasma membrane^[1][2].

Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED₅₀ for this effect is 77.69 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED₅₀ for this effect is 77.69 ng/mL.

Rat

HEK293

C-6*His

G3V8S1 (M1-A270)

/

Partial

MALGRCFPEGCTVEGAAVKQVSWFLIYSCVCSCVCWGVSVPAQEGGRKAGTFTCFSNSVFRIDCHWSAPEPGSRAWLLFTSNQVTDIKHKCTFWDSRCTLVLPKEEAFLPFDNFTITLHRCVMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISFGLEPLITSLSYELAFKRQEEAWEQARLKDRIVGVTWLVLEAIELNPDTIYEARLRVQMALESYDDKTEGEYYKSHWSEWSQSVSFPSPRRKTQGLLIPRWQGSA

Approximately 33-40 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.