1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. IL1RAPL1 Protein, Human (HEK293, His)

IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL1RAPL1 Protein emerges as a multifaceted regulator, potentially influencing secretion and presynaptic differentiation by inhibiting the activity of the N-type voltage-gated calcium channel. Additionally, it may activate the MAP kinase JNK, indicating its potential involvement in intracellular signaling pathways. IL1RAPL1 is implicated in neurite outgrowth, emphasizing its role in neuronal development. Remarkably, during dendritic spine formation, IL1RAPL1 demonstrates bidirectional capabilities, inducing both pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD. The diverse functional roles proposed for IL1RAPL1 underscore its significance in orchestrating complex cellular processes associated with synaptic function, neuronal development, and intracellular signaling pathways, warranting further exploration into its precise molecular mechanisms and broader implications in neuronal biology.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NZN1-1 (L19-T357)

Gene ID
Molecular Construction
N-term
IL1RAPL1 (L19-T357)
Accession # Q9NZN1-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-1 Receptor Accessory Protein-Like 1; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; Oligophrenin-4; Three Immunoglobulin Domain-Containing IL-1 Receptor-Related 2; TIGIRR-2; X-Linked Interleukin-1 Receptor Accessory Protein-Like 1; IL1RAPL1; OPHN4
AA Sequence

LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Predicted Molecular Mass
40 kDa
분자량

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US;may vary elsewhere.

각종 서류

IL1RAPL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL1RAPL1 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL1RAPL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70923
수량:
MCE Japan Authorized Agent: