IL1RAPL1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
IL1RAPL1 Protein emerges as a multifaceted regulator, potentially influencing secretion and presynaptic differentiation by inhibiting the activity of the N-type voltage-gated calcium channel. Additionally, it may activate the MAP kinase JNK, indicating its potential involvement in intracellular signaling pathways. IL1RAPL1 is implicated in neurite outgrowth, emphasizing its role in neuronal development. Remarkably, during dendritic spine formation, IL1RAPL1 demonstrates bidirectional capabilities, inducing both pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD. The diverse functional roles proposed for IL1RAPL1 underscore its significance in orchestrating complex cellular processes associated with synaptic function, neuronal development, and intracellular signaling pathways, warranting further exploration into its precise molecular mechanisms and broader implications in neuronal biology.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9NZN1-1 (L19-T357)
-
Molecular Construction
-
N-term
-
IL1RAPL1 (L19-T357)
Accession # Q9NZN1-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL1RAPL1; Interleukin-1 Receptor Accessory Protein-Like 1; Prev. IL1RAPL; Oligophrenin-4; Prev. MRX10; IL-1-RAPL-1; Prev. MRX21; IL-1RAPL-1; Prev. MRX34; Interleukin 1 Receptor Accessory Protein-Like 1; IL1RAPL-1; Mental Retardation, X-Linked 34; TIGIRR-2
-
AA Sequence
LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
