Copy Link Print Information

Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Intelectin-1/ITLN1 is a lectin with specific affinity for microbial carbohydrate chains and recognizes β-linked D-galactofuranosose, D-glycerolphosphate modified glycans, D-glycerol-D-talo-oct- 2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-keto acid (KDO). It binds to bacterial glycans and helps defend against microorganisms. Intelectin-1/ITLN1 Protein, Human (N-His, C-myc) is the recombinant human-derived Intelectin-1/ITLN1 protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Intelectin-1/ITLN1 is a lectin with specific affinity for microbial carbohydrate chains and recognizes β-linked D-galactofuranosose, D-glycerolphosphate modified glycans, D-glycerol-D-talo-oct- 2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-keto acid (KDO). It binds to bacterial glycans and helps defend against microorganisms. Intelectin-1/ITLN1 Protein, Human (N-His, C-myc) is the recombinant human-derived Intelectin-1/ITLN1 protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

The Intelectin-1/ITLN1 protein operates as a lectin with a specific affinity for microbial carbohydrate chains in a calcium-dependent manner. It recognizes microbial glycans containing a terminal acyclic 1,2-diol moiety, such as beta-linked D-galactofuranose (beta-Galf), D-phosphoglycerol-modified glycans, D-glycero-D-talo-oct-2-ulosonic acid (KO), and 3-deoxy-D-manno-oct-2-ulosonic acid (KDO). This lectin binds to glycans found in both Gram-positive and Gram-negative bacteria, including K. pneumoniae, S. pneumoniae, Y. pestis, P. mirabilis, and P. vulgaris, while showing no affinity for human glycans. Likely contributing to the defense system against microorganisms, Intelectin-1/ITLN1 may function as an adipokine with a potential role in glucose uptake regulation and insulin-stimulated glucose uptake in adipocytes. It enhances AKT phosphorylation, both in the absence and presence of insulin. Additionally, Intelectin-1/ITLN1 may interact with lactoferrin/LTF, increasing its uptake and potentially playing a role in iron absorption. The protein forms homotrimers through disulfide linkages and may interact with lactoferrin/LTF.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ITLN1 Protein at 2 μg/mL (100 μL/well) can bind Anti-ITLN1 Polyclonal antibody. The ED50 for this effect is 5-15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human ITLN1 Protein at 2 μg/mL (100 μL/well) can bind Anti-ITLN1 Polyclonal antibody. The ED50 for this effect is 7.12 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession

    Q8WWA0 (T19-S298)

  • Gene ID
    55600
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ITLN1; Galactofuranose-Binding Lectin; Intelectin 1; Endothelial Lectin HL-1; ITLN; Intelectin-1; LFR; FLJ20022; Omentin; ITLN-1; HIntL; INTL; HL-1; Intelectin Variant; Intelectin 1 (Galactofuranose Binding); HL1; Intestinal Lactoferrin Receptor

  • AA Sequence

    TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human ITLN1 Protein at 2 μg/mL (100 μL/well) can bind Anti-ITLN1 Polyclonal antibody. The ED50 for this effect is 7.12 ng/mL.

  • 1/16

    Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h

  • Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc) Product Image
    1/16
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Experimental Validation Results for Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc)
  • Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc) Product Image

  • Intelectin-1/ITLN1 Protein, Human (N-His, C-Myc) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h