1. Recombinant Proteins
  2. Others
  3. IRF5 Protein, Mouse (His-SUMO)

IRF5 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IRF5, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IRF5 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IRF5, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,

Background

IRF5, a critical transcription factor, assumes a pivotal role in innate immunity by orchestrating the activation of type I interferon (IFN) genes, including IFNA and INFB, and inflammatory cytokines downstream of endolysosomal toll-like receptors (TLR7, TLR8, and TLR9). It functions as a key regulator in the transcription of type I IFN genes and IFN-stimulated genes (ISG) by binding to the interferon-stimulated response element (ISRE) in their promoters. Notably, IRF5 efficiently activates both IFN-beta (IFNB) and IFN-alpha (IFNA) genes, mediating their induction through the TLR-activated, MyD88-dependent pathway. Particularly relevant in the context of SARS-CoV-2 infection, IRF5 stands out as a significant transcriptional regulator of the IFN response. Maintained as a monomer in an autoinhibited state, its activation involves phosphorylation facilitated by the innate adapter protein TASL, which recruits IRF5, licensing it for phosphorylation by IKBKB. Subsequent steps involve the dissociation of phosphorylated IRF5 from adapter proteins, its dimerization, and nuclear entry to induce IFNs.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P56477 (M1-Q497)

Gene ID

27056

Protein Length

Full Length

Synonyms
Irf5Interferon regulatory factor 5; IRF-5
AA Sequence

MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ

Predicted Molecular Mass
72.0 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IRF5 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IRF5 Protein, Mouse (His-SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IRF5 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P702592
Quantity:
MCE Japan Authorized Agent: