IRF5 Protein, Mouse (His-SUMO)
IRF5 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IRF5, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IRF5 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IRF5, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,
IRF5, a critical transcription factor, assumes a pivotal role in innate immunity by orchestrating the activation of type I interferon (IFN) genes, including IFNA and INFB, and inflammatory cytokines downstream of endolysosomal toll-like receptors (TLR7, TLR8, and TLR9). It functions as a key regulator in the transcription of type I IFN genes and IFN-stimulated genes (ISG) by binding to the interferon-stimulated response element (ISRE) in their promoters. Notably, IRF5 efficiently activates both IFN-beta (IFNB) and IFN-alpha (IFNA) genes, mediating their induction through the TLR-activated, MyD88-dependent pathway. Particularly relevant in the context of SARS-CoV-2 infection, IRF5 stands out as a significant transcriptional regulator of the IFN response. Maintained as a monomer in an autoinhibited state, its activation involves phosphorylation facilitated by the innate adapter protein TASL, which recruits IRF5, licensing it for phosphorylation by IKBKB. Subsequent steps involve the dissociation of phosphorylated IRF5 from adapter proteins, its dimerization, and nuclear entry to induce IFNs.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P56477 (M1-Q497)
-
Gene ID27056
-
Protein Length
Full Length
-
Synonyms
IRF5; Interferon Regulatory Factor 5 Transcript Variant 15; Interferon Regulatory Factor 5; Interferon Regulatory Factor 5 Transcript Variant 17; IRF-5; Interferon Regulatory Factor 5 Variant 7; Interferon Regulatory Factor 5 Transcript Variant 16; Interf
-
AA Sequence
MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ
-
Predicted Molecular Mass
72 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
