ISG15/UCRP Protein, Mouse (His)
ISG15/UCRP Protein, Mouse (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ISG15/UCRP Protein, Mouse (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli, with N-6*His labeled tag.
Background
ISG15/UCRP is a ubiquitin-like protein that plays a pivotal role in the innate immune response to viral infection, either through conjugation to target proteins (ISGylation) or as a free protein. ISGylation involves an enzymatic cascade mediated by E1, E2, and E3 enzymes, leading to the covalent attachment of ISG15 to lysine residues on target proteins such as IFIT1, MX1/MxA, and PPM1B. ISG15 modulates diverse cellular functions via ISGylation, including activation of EIF2AK2/PKR, inhibition of RIGI's antiviral signaling, and enhancement of EIF4E2's translation-suppressive activity. It exhibits broad-spectrum antiviral activity against both DNA and RNA viruses (e.g., influenza A, HIV-1, and Ebola virus) by disrupting viral budding or impairing viral protein functions. The secreted form of ISG15 acts as a cytokine, inducing NK cell proliferation, neutrophil chemotaxis, and ITGAL/ITGB2-mediated activation of SRC family kinases (e.g., LYN, HCK, FGR) to promote IFNG and IL10 secretion, contributing to antimycobacterial immunity.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q64339 (M1-R151)
-
Gene ID100038882
-
Molecular Construction
-
N-term
-
6*His
-
ISG15 (M1-R151)
Accession # Q64339 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ISG15; Interferon-Induced 17 KDa Protein; Prev. G1P2; HUCRP; UCRP; IP17; Ubiquitin Cross-Reactive Protein; Interferon-Induced 17-KDa/15-KDa Protein; Ubiquitin-Like Protein ISG15; Interferon-Stimulated Protein, 15 KDa; IFI15; IMD38; Interferon, Alpha-Inducible Protein (Clone IFI-15K); ISG15 Ubiquitin Like Modifier; Interferon-Induced 15 KDa Protein
-
AA Sequence
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLR
-
Predicted Molecular Mass
19.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)