ITPRIPL1 Protein, Human (HEK293, His)
ITPRIPL1 Protein, Human (HEK293, His) is the recombinant human-derived ITPRIPL1 protein, expressed by HEK293, with C-10*His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ITPRIPL1 Protein, Human (HEK293, His) is the recombinant human-derived ITPRIPL1 protein, expressed by HEK293, with C-10*His tag.
Background
ITPRIPL1 functions as a ligand of CD3E, inhibiting TCR-CD3 complex signaling to regulate T cell activation. It induces stable CD3E-NCK1 binding, thereby preventing the CD3E-ZAP70 interaction and subsequently inhibiting the activation of the downstream ERK-NFkB signaling cascade and calcium influx.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q6GPH6 (H25-G103)
-
Gene ID150771
-
Molecular Construction
-
N-term
-
ITPRIPL1 (H25-G103)
Accession # Q6GPH6 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ITPRIPL1; Inositol 1,4,5-Trisphosphate Receptor-Interacting Protein-Like 1; Prev. KIAA1754L; Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1; D1B; Inositol 1,4,5-Triphosphate Receptor-Interacting Protein-Like 1; Inositol 1,4,5-Trisphosphat
-
AA Sequence
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
-
Predicted Molecular Mass
10.7 kDa
-
Molecular Weight
Approximately 11 kDa & 13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
