JAM-B/CD322 Protein, Rat (HEK293, Fc)
Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, Fc) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, Fc) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Jam2 also has integrin alpha-4/beta-1 binding activity and plays an important role in numerous cellular processes, such as tight junction assembly, spermatogenesis, regulation of paracellular permeability, leukocytic transmigration, angiogenesis, tumor metastasis and cell proliferation. Additionally, Jam2 functions as an inhibitory somatodendritic cue, preventing the myelination of non-axonal parts of neurons, contributes to myocyte fusion during myogenesis [1][2][3].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q3MHC0 (F29-N236)
-
Molecular Construction
-
N-term
-
JAM-A (F29-N236)
Accession # Q3MHC0 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
JAM2; CD322; Prev. C21orf43; VEJAM; VE-JAM; JAM-IT/VE-JAM; JAM-B; CD322 Antigen; JAM-2; PRO245; Vascular Endothelial Junction-Associated Molecule; IBGC8; Junctional Adhesion Molecule B; Junctional Adhesion Molecule 2; JAMB
-
AA Sequence
FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN
-
Predicted Molecular Mass
50.3 kDa
-
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Cunningham SA, et al. JAM2 interacts with alpha4beta1. Facilitation by JAM3. J Biol Chem. 2002 Aug 2;277(31):27589-92. [Content Brief]
[2]. Johnson-Léger CA, et al. Junctional adhesion molecule-2 (JAM-2) promotes lymphocyte transendothelial migration. Blood. 2002 Oct 1;100(7):2479-86. [Content Brief]
[3]. Arcangeli ML, et al. Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells. Stem Cells. 2014 Apr;32(4):1043-54. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
