Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9, Avi)

The Janus kinase 2 (JAK2) protein is a critical non-receptor tyrosine kinase that drives important cellular processes affecting growth, development, differentiation, and histone modifications. JAK2 plays a role in innate and adaptive immunity, interacting with receptors such as growth hormone, erythropoietin, and interleukins. Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9) is the recombinant human-derived Janus kinase 2/JAK2 protein, expressed by Sf9 insect cells, with tag free.

Janus kinase 2 (JAK2) protein, a non-receptor tyrosine kinase, orchestrates critical cellular processes such as cell growth, development, differentiation, and histone modifications. Operating in both innate and adaptive immunity, JAK2 engages with various receptors, including growth hormone, prolactin, leptin, erythropoietin, thrombopoietin, interferons, and interleukins. Upon ligand binding, JAK2 phosphorylates receptor tyrosine residues, creating docking sites for STAT proteins. This initiates a signaling cascade leading to STAT activation, homodimer or heterodimer formation, and nuclear translocation, ultimately promoting gene transcription. In erythropoiesis, for instance, JAK2 activation by erythropoietin induces STAT5-mediated transcription of crucial genes. JAK2 also participates in signaling cascades activated by cellular retinol and mediates angiotensin-2-induced ARHGEF1 phosphorylation. Furthermore, JAK2 plays a role in the cell cycle by phosphorylating CDKN1B and cooperates with TEC to activate FOS transcription. Intriguingly, in the nucleus, JAK2's involvement extends to chromatin regulation through the phosphorylation of histone H3 at Tyr-41, influencing chromatin structure and function.

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

Tag Free;N-Avi

O60674-1 (T842-G1132)

3717

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 1 mM DTT, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.