1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. JMJD2A Protein, Human

The JMJD2A protein is a central histone demethylase in the histone code that specifically targets "Lys-9" and "Lys-36" of histone H3. It excludes demethylation of H3 "Lys-4", "Lys-27" and H4 "Lys-20". JMJD2A Protein, Human is the recombinant human-derived JMJD2A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The JMJD2A protein is a central histone demethylase in the histone code that specifically targets "Lys-9" and "Lys-36" of histone H3. It excludes demethylation of H3 "Lys-4", "Lys-27" and H4 "Lys-20". JMJD2A Protein, Human is the recombinant human-derived JMJD2A protein, expressed by E. coli , with tag free.

Background

JMJD2A Protein, a histone demethylase central to the intricate histone code, specifically targets 'Lys-9' and 'Lys-36' residues of histone H3. Notably, it does not demethylate histone H3 'Lys-4,' H3 'Lys-27,' nor H4 'Lys-20.' Its demethylase activity is confined to trimethylated H3 'Lys-9' and H3 'Lys-36' residues, with no discernible effect on mono- and dimethylated residues. This demethylation process generates formaldehyde and succinate as byproducts. JMJD2A participates in the transcriptional repression of ASCL2 and E2F-responsive promoters by recruiting histone deacetylases and NCOR1, respectively. With a critical role in muscle differentiation, JMJD2A promotes the transcriptional activation of the Myog gene by orchestrating the removal of repressive chromatin marks at its promoter. Noteworthy is the absence of the N-terminal demethylase domain in JMJD2A, highlighting its unique structural features and functional significance in chromatin dynamics and gene regulation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O75164 (M1-L359)

Gene ID

9682

Molecular Construction
N-term
JMJD2A (M1-L359)
Accession # O75164
C-term
Protein Length

Partial

Synonyms
KDM4A; Lysine-specific demethylase 4A; JmjC domain-containing histone demethylation protein 3A; Jumonji domain-containing protein 2A; [histone H3]-trimethyl-L-lysine(36) demethylase 4A; [histone H3]-trimethyl-L-lysine(9) demethylase 4A
AA Sequence

MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESEL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

JMJD2A Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

JMJD2A Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JMJD2A Protein, Human
Cat. No.:
HY-P701618
Quantity:
MCE Japan Authorized Agent: