JMJD2A Protein, Human
The JMJD2A protein is a central histone demethylase in the histone code that specifically targets "Lys-9" and "Lys-36" of histone H3. It excludes demethylation of H3 "Lys-4", "Lys-27" and H4 "Lys-20". JMJD2A Protein, Human is the recombinant human-derived JMJD2A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The JMJD2A protein is a central histone demethylase in the histone code that specifically targets "Lys-9" and "Lys-36" of histone H3. It excludes demethylation of H3 "Lys-4", "Lys-27" and H4 "Lys-20". JMJD2A Protein, Human is the recombinant human-derived JMJD2A protein, expressed by E. coli , with tag free.
Background
JMJD2A Protein, a histone demethylase central to the intricate histone code, specifically targets 'Lys-9' and 'Lys-36' residues of histone H3. Notably, it does not demethylate histone H3 'Lys-4,' H3 'Lys-27,' nor H4 'Lys-20.' Its demethylase activity is confined to trimethylated H3 'Lys-9' and H3 'Lys-36' residues, with no discernible effect on mono- and dimethylated residues. This demethylation process generates formaldehyde and succinate as byproducts. JMJD2A participates in the transcriptional repression of ASCL2 and E2F-responsive promoters by recruiting histone deacetylases and NCOR1, respectively. With a critical role in muscle differentiation, JMJD2A promotes the transcriptional activation of the Myog gene by orchestrating the removal of repressive chromatin marks at its promoter. Noteworthy is the absence of the N-terminal demethylase domain in JMJD2A, highlighting its unique structural features and functional significance in chromatin dynamics and gene regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O75164 (M1-L359)
-
Gene ID9682
-
Molecular Construction
-
N-term
-
JMJD2A (M1-L359)
Accession # O75164 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KDM4A; [Histone H3]-Trimethyl-L-Lysine(9) Demethylase 4A; Prev. JMJD2A; Lysine (K)-Specific Demethylase 4A; Prev. JMJD2; Lysine-Specific Demethylase 4A; JHDM3A; Jumonji Domain Containing 2A; KIAA0677; Tudor Domain Containing 14A; TDRD14A; Jumonji Domain C
-
AA Sequence
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESEL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)