JOSD2 Protein, Human
The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
Biological Activity
The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.
JOSD2 (Josephin-2) protein functions as a deubiquitinating enzyme, exhibiting cleavage activity on 'Lys-63'-linked poly-ubiquitin chains with high efficiency and, to a lesser extent, on 'Lys-48'-linked poly-ubiquitin chains in vitro. The enzyme's ability to specifically target and cleave these distinct poly-ubiquitin linkages suggests its involvement in regulating various cellular processes, including protein degradation and signaling pathways mediated by ubiquitination. While further research is needed to elucidate its specific physiological roles, the identified deubiquitinating activity positions JOSD2 as a potential key player in modulating ubiquitin-dependent cellular mechanisms (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8TAC2-1 (S2-D188)
-
Gene ID126119
-
Molecular Construction
-
N-term
-
JOSD2 (S2-D188)
Accession # Q8TAC2-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
JOSD2; Josephin Domain-Containing Protein 2; Josephin Domain Containing 2; SBBI54; Josephin-2
-
AA Sequence
SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)