Kallikrein-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability. Kallikrein-2 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability. Kallikrein-2 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Kallikrein-2 is a member of the glandular kallikrein family, exhibiting enzymatic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, resulting in the release of Lys-bradykinin. As part of the kinin-kallikrein system, Kallikrein-2 contributes to the generation of bradykinin, a potent vasoactive peptide involved in the regulation of blood pressure, inflammation, and vascular permeability. By specifically cleaving these bonds in kininogen, Kallikrein-2 plays a crucial role in the controlled release of Lys-bradykinin, influencing downstream physiological processes.

Verified Bioactivity

Measured by its ability to cleave a flourogenic peptide substrate Z-Phe-Arg-7-amido-4-methylcoumarin (FR-AMC). The specific activity is >125 pmol/min/μg.

Assay Procedure

Materials
Assay buffer: 50 mM Tris-HCl, 0.15 M NaCl, 10 mM CaCl?, 0.05% (w/v) Brij-35, pH 7.5
Test protein: Kallikrein-2 Protein, Human (HEK293, His)
Substrate: Z-Phe-Arg-AMC, 10 mM stock in DMSO
Standard: AMC, 10 mM stock in DMSO

Procedure
1. Prepare calibration curve: Dilute the standard solution to 3 μM with assay buffer, then perform six serial dilutions. Dispense 100 μL of each dilution into black microplate wells. Read in kinetic mode for 5 minutes at excitation (380 nm) and emission (460 nm) wavelengths (top read). Plot the standard curve with measured RFU on the y-axis and standard substance amount on the x-axis to obtain the standard curve equation.
2. Dilute Human Kallikrein-2 to 5 μg/mL in assay buffer.
3. Dilute substrate Z-Phe-Arg-AMC to 200 μM in assay buffer.
4. Instrument Settings: Select Kinetic and Fluorescence functions. For Kinetic mode, set 11 cycles with 30-second intervals between cycles. For Fluorescence, set excitation at 380 nm and emission at 460 nm. 5. Experimental group: 50 μL, 5 μg/mL protein + 50 μL, 200 μM substrate.
Blank group: 50 μL assay buffer + 50 μL, 200 μM substrate.
6. Reading: Place the microplate into the microplate reader for reading.
7. Calculate specific activity:

  Specific Activity (pmol/min/μg) =
Adjusted Fluorescence* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard AMC

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Kallikrein-2 (P19-P261)
      Accession # P20151-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1 (with Propeptide)

  • Synonyms

    KLK2; Kallikrein 2 Isoform 5 Preproprotein; Kallikrein Related Peptidase 2; Kallikrein 2 Isoform 6 Preproprotein; HGK-1; Glandular Kallikrein 2; Kallikrein 2, Prostatic; Kallikrein-2 Isoform 5; Glandular Kallikrein-1; Kallikrein-2 Isoform 6; Tissue Kallik

  • AA Sequence

    PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

  • Predicted Molecular Mass

    27.9 kDa

  • Molecular Weight

    Approximately 10-12 kDa & 16-19 kDa & 28-33 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Acetate, 250 mM Trehalose, 0.02% Tween 80, pH 5.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00