Kallikrein-3/PSA Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-10*His labeled tag.
Background
Kallikrein-3 (PSA) protein plays a pivotal role in the male reproductive system by hydrolyzing semenogelin-1, a seminal vesicle protein. This enzymatic activity is responsible for initiating the liquefaction of the seminal coagulum, a critical step in sperm mobility and overall fertility. PSA's ability to cleave semenogelin-1 underscores its significance in the intricate processes involved in semen physiology and male reproductive function.
Verified Bioactivity
Measured by its ability to cleave the colorimetric peptide substrate, MeO-Suc-Arg-Pro-Tyr-pNA (HY-P5376). The specific activity is > 200 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P07288 (A18-P261)
-
Gene ID354
-
Molecular Construction
-
N-term
-
PSA (A18-P261)
Accession # P7288 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
KLK3; Kallikrein 3, (Prostate Specific Antigen), Isoform CRA_e; Prev. APS; Kallikrein 3, (Prostate Specific Antigen), Isoform CRA_d; PSA; Kallikrein 3, (Prostate Specific Antigen), Isoform CRA_f; Prostate Specific Antigen; Kallikrein 3, (Prostate Specific
-
AA Sequence
APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
-
Predicted Molecular Mass
28.2 kDa
-
Molecular Weight
Approximately 33-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Pro form
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 7.5, 0.05% Brij-35, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
