Kallikrein-5 Protein, Human (HEK293, C-His)
Based on 1 Customer Validation
The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Human (HEK293,C-His) is the recombinant human-derived Kallikrein-5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Human (HEK293,C-His) is the recombinant human-derived Kallikrein-5 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Kallikrein-5 Protein appears to play a potential role in desquamation, suggesting involvement in the intricate processes of skin shedding and exfoliation. Its potential connection to desquamation implies a functional role in regulating the removal of dead skin cells, a crucial aspect of skin homeostasis. Notably, Kallikrein-5 activity is inhibited by Zn2+, indicating a potential regulatory mechanism for its enzymatic function. Understanding the specific mechanisms through which Kallikrein-5 contributes to desquamation and the regulatory role of Zn2+ could provide valuable insights into its function in skin physiology and shed light on its potential significance in processes related to skin renewal and maintenance. Further exploration of Kallikrein-5's functions may deepen our understanding of its role in skin biology and its potential implications in various physiological contexts.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate BOC-Val-Pro-Arg-AMC (HY-137784) that incubate at room temperature in kinetic mode for 5 minutes.The specific activity is ≥3000 pmol/min/µg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9Y337 (V23-S293)
-
Gene ID25818
-
Molecular Construction
-
N-term
-
Kallikrein-5 (V23-S293)
Accession # Q9Y337 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
KLK5; KLKL2; Kallikrein Related Peptidase 5; Kallikrein-Related Peptidase 5 Transcript Variant 5; KLK-L2; Kallikrein-Related Peptidase 5 Transcript Variant 6; SCTE; Kallikrein 5 Isoform 3 Preproprotein; Stratum Corneum Tryptic Enzyme; Kallikrein 5, Isofor
-
AA Sequence
VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
-
Predicted Molecular Mass
29.6 kDa
-
Molecular Weight
Approximately 35-44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5, 10% Glycerol, 5% trehalose
2.Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5, 10% Glycerol.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
