1. Protéines recombinantes
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. KDM2A Protein, Human (His)

The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human (His) is the recombinant human-derived KDM2A protein, expressed by E. coli , with N-6*His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human (His) is the recombinant human-derived KDM2A protein, expressed by E. coli , with N-6*His labeled tag.

Background

KDM2A Protein, a histone demethylase, assumes a pivotal role in the histone code by specifically targeting 'Lys-36' of histone H3. This enzyme exhibits a preference for demethylating the dimethylated H3 'Lys-36' residue, displaying weak or no activity towards mono- and tri-methylated H3 'Lys-36.' Beyond its histone demethylase function, KDM2A showcases versatility by recognizing and binding to certain phosphorylated proteins, promoting their ubiquitination and subsequent degradation. Essential for maintaining the heterochromatic state, KDM2A associates with centromeres, where it represses the transcription of small non-coding RNAs encoded by satellite repeat clusters, crucial for centromeric integrity and genomic stability, particularly during mitosis. Moreover, KDM2A exerts influence over circadian gene expression by suppressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer and RORA, demonstrating a catalytically-independent regulatory role in circadian rhythms. The multifaceted functions of KDM2A underscore its significance in the intricate orchestration of chromatin dynamics and cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y2K7 (R567-S681)

Gene ID

22992

Molecular Construction
N-term
6*His
KDM2A (R567-S681)
Accession # Q9Y2K7
C-term
Protein Length

Partial

Synonyms
KDM2A; Lysine-specific demethylase 2A; CXXC-type zinc finger protein 8; F-box and leucine-rich repeat protein 11; F-box protein FBL7; F-box protein Lilina; F-box/LRR-repeat protein 11; JmjC domain-containing histone demethylation protein 1A; [Histone-H3]-lysine-36 demethylase 1A
AA Sequence

RRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSS

Pureté

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

KDM2A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

KDM2A Protein, Human (His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
KDM2A Protein, Human (His)
Cat. No.:
HY-P701622
Quantité:
MCE Japan Authorized Agent: