KDM2A Protein, Human
The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human is the recombinant human-derived KDM2A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human is the recombinant human-derived KDM2A protein, expressed by E. coli , with tag free.
Background
KDM2A Protein, a histone demethylase, assumes a pivotal role in the histone code by specifically targeting 'Lys-36' of histone H3. This enzyme exhibits a preference for demethylating the dimethylated H3 'Lys-36' residue, displaying weak or no activity towards mono- and tri-methylated H3 'Lys-36.' Beyond its histone demethylase function, KDM2A showcases versatility by recognizing and binding to certain phosphorylated proteins, promoting their ubiquitination and subsequent degradation. Essential for maintaining the heterochromatic state, KDM2A associates with centromeres, where it represses the transcription of small non-coding RNAs encoded by satellite repeat clusters, crucial for centromeric integrity and genomic stability, particularly during mitosis. Moreover, KDM2A exerts influence over circadian gene expression by suppressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer and RORA, demonstrating a catalytically-independent regulatory role in circadian rhythms. The multifaceted functions of KDM2A underscore its significance in the intricate orchestration of chromatin dynamics and cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y2K7 (R567-S681)
-
Gene ID22992
-
Molecular Construction
-
N-term
-
KDM2A (R567-S681)
Accession # Q9Y2K7 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KDM2A; [Histone-H3]-Lysine-36 Demethylase 1A; Prev. FBXL11; CXXC-Type Zinc Finger Protein 8; JHDM1A; Lysine-Specific Demethylase 2A; FBL11; F-Box/LRR-Repeat Protein 11; CXXC8; DKFZP434M1735; FBL7; FLJ00115; F-Box And Leucine-Rich Repeat Protein 11; [Histo
-
AA Sequence
RRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)