KDM2A Protein, Human

The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human is the recombinant human-derived KDM2A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The KDM2A protein is a histone demethylase targeting "Lys-36" of histone H3. It plays a key role in the histone code, especially the demethylation of dimethylated H3 "Lys-36". Methylation. In addition to histone demethylation, KDM2A also recognizes and binds phosphorylated proteins, promoting their ubiquitination and degradation. KDM2A Protein, Human is the recombinant human-derived KDM2A protein, expressed by E. coli , with tag free.

Background

KDM2A Protein, a histone demethylase, assumes a pivotal role in the histone code by specifically targeting 'Lys-36' of histone H3. This enzyme exhibits a preference for demethylating the dimethylated H3 'Lys-36' residue, displaying weak or no activity towards mono- and tri-methylated H3 'Lys-36.' Beyond its histone demethylase function, KDM2A showcases versatility by recognizing and binding to certain phosphorylated proteins, promoting their ubiquitination and subsequent degradation. Essential for maintaining the heterochromatic state, KDM2A associates with centromeres, where it represses the transcription of small non-coding RNAs encoded by satellite repeat clusters, crucial for centromeric integrity and genomic stability, particularly during mitosis. Moreover, KDM2A exerts influence over circadian gene expression by suppressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer and RORA, demonstrating a catalytically-independent regulatory role in circadian rhythms. The multifaceted functions of KDM2A underscore its significance in the intricate orchestration of chromatin dynamics and cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • KDM2A (R567-S681)
      Accession # Q9Y2K7
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KDM2A; Lysine-specific demethylase 2A; CXXC-type zinc finger protein 8; F-box and leucine-rich repeat protein 11; F-box protein FBL7; F-box protein Lilina; F-box/LRR-repeat protein 11; JmjC domain-containing histone demethylation protein 1A; [Histone-H3]-lysine-36 demethylase 1A

  • AA Sequence

    RRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00