Copy Link Print Information

KGF-2/FGF-10 Protein, Human (N-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (N-His) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (N-His)
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (N-His)
  • KGF-2/FGF-10 Protein, Human (N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (N-His) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His labeled tag.

Background

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 9.599-57.42 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 9.599 ng/mL, corresponding to a specific activity is 1.042×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    O15520 (L40-S208)

  • Gene ID
    2255  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FGF-10 (L40-S208)
      Accession # O15520
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF10; Produced By Fibroblasts Of Urinary Bladder Lamina Propria; Fibroblast Growth Factor 10; Fibroblast Growth Factor; Keratinocyte Growth Factor 2; LADD3; FGF-10; FGF

  • AA Sequence

    LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

  • Predicted Molecular Mass

    19.4 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 9.599 ng/mL, corresponding to a specific activity is 1.042×105 units/mg.

  • KGF-2/FGF-10 Protein, Human (N-His) Product Image
    1/16
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (N-His)
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (N-His)
  • KGF-2/FGF-10 Protein, Human (N-His) Product Image