KIR2DL5/CD158f Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR2DL5/CD158f, expressed on natural killer (NK) cells, functions as a receptor for HLA-C alleles. This receptor operates in an inhibitory manner, regulating NK cell activity to prevent cell lysis. By interacting with specific HLA-C molecules, KIR2DL5 contributes to the delicate balance of inhibitory signals in the immune system, fine-tuning the response of NK cells to potential targets.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD158f (H22-H240)
      Accession # Q8N109
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    KIR2DL5A; Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 5; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 5A; Killer Cell Immunoglobulin-Like Receptor KIR2DL5A; KIR2DL5; Killer Cell Immun

  • AA Sequence

    HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH

  • Predicted Molecular Mass

    26.3 kDa

  • Molecular Weight

    Approximately 45-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00