Copy Link Print Information

KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR3DL2/CD158k, a receptor expressed on natural killer (NK) cells and T cells, plays a pivotal role in recognizing MHC class I molecules. Upon binding to the peptide-free HLA-F open conformer, KIR3DL2 exerts a negative regulatory influence on NK and T cell effector functions, contributing to the intricate modulation of immune responses. Beyond its immune cell role, KIR3DL2 also serves as a receptor on astrocytes for HLA-F, potentially safeguarding motor neurons from astrocyte-induced toxicity through interactions with HLA-F. This multifaceted engagement underscores the diverse functions of KIR3DL2 in both immune regulation and neural protection.

Verified Bioactivity

Immobilized Human KIR3DL2, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Anti-KIR3DL2 Antibody, hFc Tag with the EC50 of <0.62μg/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    P43630-1 (L22-L339)

  • Gene ID
    3812  [NCBI]
  • Molecular Construction
    • N-term
    • CD158k (L22-L339)
      Accession # P43630-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KIR3DL2; Cl-5; Killer Cell Immunoglobulin Like Receptor, Three Ig Domains And Long Cytoplasmic Tail 2; 3DL2; CD158K; Killer Cell Immunoglobulin-Like Receptor Three Domains Long Cytoplasmic Tail 2; Killer Cell Immunoglobulin-Like Receptor 3DL2; Killer-Cell

  • AA Sequence

    LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHL

  • Predicted Molecular Mass

    37.9 kDa

  • Molecular Weight

    Approximately 40-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) Product Image
    1/16
  • KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) Product Image