1. Recombinant Proteins
  2. Others
  3. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)

KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P77975
Handling Instructions Technical Support

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg Get quote
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR3DL2/CD158k, a receptor expressed on natural killer (NK) cells and T cells, plays a pivotal role in recognizing MHC class I molecules. Upon binding to the peptide-free HLA-F open conformer, KIR3DL2 exerts a negative regulatory influence on NK and T cell effector functions, contributing to the intricate modulation of immune responses. Beyond its immune cell role, KIR3DL2 also serves as a receptor on astrocytes for HLA-F, potentially safeguarding motor neurons from astrocyte-induced toxicity through interactions with HLA-F. This multifaceted engagement underscores the diverse functions of KIR3DL2 in both immune regulation and neural protection.

Biological Activity

Immobilized Human KIR3DL2, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Anti-KIR3DL2 Antibody, hFc Tag with the EC50 of <0.62μg/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P43630-1 (L22-L339)

Gene ID
Molecular Construction
N-term
CD158k (L22-L339)
Accession # P43630-1
8*His-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
NKAT-4; NKAT4; CD158k; CL-5; KIR3DL2; NKAT4A; NKAT4B; p140
AA Sequence

LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHL

Molecular Weight

40-70 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P77975
Quantity:
MCE Japan Authorized Agent: