KIR3DL2/CD158k Protein, Human (HEK293, His-Avi)

KIR3DL2/CD158k is expressed on NK and T cells and recognizes MHC class I, specifically the peptide-free open conformer of HLA-F. Binding to HLA-F negatively regulates NK and T cell effector functions, thereby complexly modulating immune responses. KIR3DL2/CD158k Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR3DL2/CD158k protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

KIR3DL2/CD158k, a receptor expressed on natural killer (NK) cells and T cells, plays a pivotal role in recognizing MHC class I molecules. Upon binding to the peptide-free HLA-F open conformer, KIR3DL2 exerts a negative regulatory influence on NK and T cell effector functions, contributing to the intricate modulation of immune responses. Beyond its immune cell role, KIR3DL2 also serves as a receptor on astrocytes for HLA-F, potentially safeguarding motor neurons from astrocyte-induced toxicity through interactions with HLA-F. This multifaceted engagement underscores the diverse functions of KIR3DL2 in both immune regulation and neural protection.

Immobilized Human KIR3DL2, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Anti-KIR3DL2 Antibody, hFc Tag with the EC₅₀ of <0.62μg/ml determined by ELISA.

Human

HEK293

C-Avi;C-8*His

P43630-1 (L22-L339)

3812  [NCBI]

Extracellular Domain

LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHL

40-70 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.