KLF6 Protein, Human
Based on 1 Customer Validation
KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.
KLF6, a transcriptional activator, is characterized by its ability to bind to GC box motifs, suggesting its involvement in the regulation of gene expression. With potential implications in B-cell growth and development, KLF6 is likely to contribute to the intricate transcriptional network governing cellular processes. Notably, its interaction with ZZEF1 adds a layer of complexity, hinting at potential regulatory pathways and molecular connections that underscore KLF6's role in cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99612-3 (M1-S109)
-
Molecular Construction
-
N-term
-
KLF6 (M1-S109)
Accession # Q99612-3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KLF6; B-Cell-Derived Protein 1; Prev. COPEB; GC-Rich Binding Factor; Prev. BCD1; Krueppel-Like Factor 6; Prev. ST12; Kruppel Like Factor 6; CPBP; Proto-Oncogene BCD1; PAC1; Suppression Of Tumorigenicity 12 (Prostate); GBF; Core Promoter Element-Binding Pr
-
AA Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 13-19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
