KLRB1F/CD161f Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The KLRB1F/CD161f protein is thought to bind CLEC2I/Clr-g, activate natural killer cells and provide costimulation for IL-2 production and T cell proliferation. This dual function highlights its critical role in coordinating immune responses. KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRB1F/CD161f protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The KLRB1F/CD161f protein is thought to bind CLEC2I/Clr-g, activate natural killer cells and provide costimulation for IL-2 production and T cell proliferation. This dual function highlights its critical role in coordinating immune responses. KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRB1F/CD161f protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The KLRB1F/CD161f Protein is known for its capability to bind CLEC2I/Clr-g, initiating the activation of natural killer cells or providing costimulation for IL-2 production and T-cell proliferation in response to antigen stimulation. This dual functionality underscores its role in orchestrating immune responses. Furthermore, KLRB1F/CD161f may play a role in the formation of the immunological synapse between T-cells and antigen-presenting dendritic cells, suggesting its involvement in the intricate molecular interactions that govern effective immune recognition and response.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q8VD98 (Q67-V217)
-
Gene ID232408 [NCBI]
-
Molecular Construction
-
N-term
-
hFc
-
CD161f (Q67-V217)
Accession # Q8VD98 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Killer cell lectin-like receptor subfamily B member 1F; CD161 antigen-like family member F; Natural killer cell surface protein NKR-P1F; CD161f; Klrb1f; Nkrp1f
-
AA Sequence
QKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
