KLRG1 Protein, Mouse (HEK293, Fc)
KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
KLRG1 Protein assumes a pivotal role in exerting inhibitory effects on both natural killer (NK) cells and T-cell functions through its binding to non-MHC ligands. By engaging in missing self-recognition, KLRG1 monitors the expression of classical cadherins, including E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. Existing as both a monomer and homodimer with disulfide linkage, KLRG1 employs its immunoreceptor tyrosine-based inhibitory motif (ITIM) to interact with signaling molecules such as PTPN11 and INPP5D, thereby modulating cellular responses and contributing to immune regulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
O88713 (Q57-Y188)
-
Molecular Construction
-
N-term
-
hFc
-
KLRG1 (Q57-Y188)
Accession # O88713 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRG1; Mast Cell Function-Associated Antigen; Killer Cell Lectin Like Receptor G1; ITIM-Containing Receptor MAFA-L; CLEC15A; MAFA-Like Receptor; MAFA; Mast Cell Function-Associated Antigen (ITIM-Containing); MAFA-L; C-Type Lectin Domain Family 15, Member
-
AA Sequence
QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
-
Predicted Molecular Mass
42.3 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
