KLRG1 Protein, Mouse (HEK293, Fc)

KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

KLRG1 Protein plays a pivotal role in inhibiting NK cells and T-cell functions by binding to non-MHC ligands. It engages in missing self-recognition, monitoring the expression of classical cadherins like E-cadherin/CDH1. Existing as a monomer or homodimer, KLRG1 employs its ITIM to interact with PTPN11 and INPP5D, modulating cellular responses and contributing to immune regulation. KLRG1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRG1 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

KLRG1 Protein assumes a pivotal role in exerting inhibitory effects on both natural killer (NK) cells and T-cell functions through its binding to non-MHC ligands. By engaging in missing self-recognition, KLRG1 monitors the expression of classical cadherins, including E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. Existing as both a monomer and homodimer with disulfide linkage, KLRG1 employs its immunoreceptor tyrosine-based inhibitory motif (ITIM) to interact with signaling molecules such as PTPN11 and INPP5D, thereby modulating cellular responses and contributing to immune regulation.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • KLRG1 (Q57-Y188)
      Accession # O88713
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KLRG1; Mast Cell Function-Associated Antigen; Killer Cell Lectin Like Receptor G1; ITIM-Containing Receptor MAFA-L; CLEC15A; MAFA-Like Receptor; MAFA; Mast Cell Function-Associated Antigen (ITIM-Containing); MAFA-L; C-Type Lectin Domain Family 15, Member

  • AA Sequence

    QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

  • Predicted Molecular Mass

    42.3 kDa

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00