KMT2D Protein, Human
KMT2D Protein, a histone methyltransferase, methylates histone H3 'Lys-4' (H3K4), predominantly establishing H3K4me1 marks at active chromatin sites. Integral to chromatin remodeling, it functions as a coactivator for the estrogen receptor, recruited by ESR1, activating transcription. KMT2D's role in depositing specific histone marks at genomic locations underscores its crucial involvement in modulating chromatin structure and gene expression. KMT2D Protein, Human is the recombinant human-derived KMT2D protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KMT2D Protein, a histone methyltransferase, methylates histone H3 'Lys-4' (H3K4), predominantly establishing H3K4me1 marks at active chromatin sites. Integral to chromatin remodeling, it functions as a coactivator for the estrogen receptor, recruited by ESR1, activating transcription. KMT2D's role in depositing specific histone marks at genomic locations underscores its crucial involvement in modulating chromatin structure and gene expression. KMT2D Protein, Human is the recombinant human-derived KMT2D protein, expressed by E. coli , with tag free.
Background
KMT2D Protein, a histone methyltransferase, orchestrates the transfer of methyl groups from S-adenosyl-L-methionine to the epsilon-amino group of 'Lys-4' on histone H3 (H3K4). Integral to the chromatin remodeling machinery, it predominantly establishes H3K4me1 methylation marks at active chromatin sites associated with transcription and DNA repair processes. Functioning as a coactivator for the estrogen receptor, KMT2D is recruited by ESR1, thereby activating transcription. The enzyme's activity in depositing specific histone marks at functionally relevant genomic locations underscores its crucial role in modulating chromatin structure and gene expression.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O14686 (H5382-M5536)
-
Gene ID8085
-
Molecular Construction
-
N-term
-
KMT2D (H5382-M5536)
Accession # O14686 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KMT2D; Trinucleotide Repeat Containing 21; Prev. MLL2; [Histone H3]-Lysine(4) N-Methyltransferase; Prev. TNRC21; Histone-Lysine N-Methyltransferase MLL2; Histone-Lysine N-Methyltransferase 2D; Histone-Lysine N-Methyltransferase 2C; MLL4; Truncated Lysine
-
AA Sequence
HSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWM
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
