1. Recombinant Proteins
  2. Receptor Proteins
  3. Kremen-2 Protein, Human (HEK293, His)

Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2 Protein, Human (HEK293, His) is the recombinant human-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2 Protein, Human (HEK293, His) is the recombinant human-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Kremen-2 Protein serves as a receptor for Dickkopf proteins and collaborates with DKK1/2 to inhibit Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role in the Wnt signaling pathway positions Kremen-2 as a key modulator of cellular responses to developmental cues. In limb development, Kremen-2 plays a crucial role by attenuating Wnt signaling, contributing to normal limb patterning, and negatively regulating bone formation. Its interaction with ERLEC1 and formation of a ternary complex with DKK1 and LRP6 underscore the intricate molecular mechanisms through which Kremen-2 participates in the fine-tuning of Wnt signaling and developmental processes.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

Q8NCW0-1 (G26-A364)

Gene ID
Molecular Construction
N-term
Kremen-2 (G26-A364)
Accession # Q8NCW0-1
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
KRM2; KREMEN2; Kremen-2; Dickkopf receptor 2
AA Sequence

GSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAA

Predicted Molecular Mass
37.1 kDa
Molecular Weight

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Kremen-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Kremen-2 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kremen-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P77976
Quantity:
MCE Japan Authorized Agent: