KRT19 Protein, Canine (His)

Customer Review

Based on 1 Customer Validation

KRT19 Protein, Canine (His) is the recombinant canine-derived KRT19 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

KRT19 Protein, Canine (His) is the recombinant canine-derived KRT19 protein, expressed by E. coli, with N-His labeled tag.

Background

Cytokeratin is a protein involved in the organization of myofibers. Together with KRT8, it helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • KRT19 (Q310-L399)
      Accession # NP_001240671.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KRT19; Keratin, Type I, 40-Kd; Keratin 19; Keratin 19, Type I; Keratin, Type I Cytoskeletal 19; Cytokeratin 19; K19; Cytokeratin-19; CK19; Keratin-19; K1CS; MGC15366; 40-KDa Keratin Intermediate Filament; CK-19

  • AA Sequence

    QSQLSMKAALEGTLAETEARFGAQLAQIQALISSMEAQLSDVRADTERQNQEYQQLMDIKSRLEQEIATYRSLLEGQDAHYNNLPTPKAL

  • Predicted Molecular Mass

    21.8 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00