KRT19 Protein, Canine (His)
Based on 1 Customer Validation
KRT19 Protein, Canine (His) is the recombinant canine-derived KRT19 protein, expressed by E. coli, with N-His labeled tag.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
KRT19 Protein, Canine (His) is the recombinant canine-derived KRT19 protein, expressed by E. coli, with N-His labeled tag.
Cytokeratin is a protein involved in the organization of myofibers. Together with KRT8, it helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag N-8*His
-
Accession
NP_001240671.1 (Q310-L399)
-
Molecular Construction
-
N-term
-
8*His
-
KRT19 (Q310-L399)
Accession # NP_001240671.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KRT19; Keratin, Type I, 40-Kd; Keratin 19; Keratin 19, Type I; Keratin, Type I Cytoskeletal 19; Cytokeratin 19; K19; Cytokeratin-19; CK19; Keratin-19; K1CS; MGC15366; 40-KDa Keratin Intermediate Filament; CK-19
-
AA Sequence
QSQLSMKAALEGTLAETEARFGAQLAQIQALISSMEAQLSDVRADTERQNQEYQQLMDIKSRLEQEIATYRSLLEGQDAHYNNLPTPKAL
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)