KRT19 Protein, Canine (His)

KRT19 Protein, Canine (His) is the recombinant canine-derived KRT19 protein, expressed by E. coli, with N-His labeled tag.

Cytokeratin is a protein involved in the organization of myofibers. Together with KRT8, it helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.

Canine

E. coli

N-8*His

NP_001240671.1 (Q310-L399)

100685481  [NCBI]

Partial

QSQLSMKAALEGTLAETEARFGAQLAQIQALISSMEAQLSDVRADTERQNQEYQQLMDIKSRLEQEIATYRSLLEGQDAHYNNLPTPKAL

21.84 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.