1. Recombinant Proteins
  2. Others
  3. Ku70-Ku80 Heterodimer Protein, Human (sf9, His)

Ku70-Ku80 Heterodimer Protein, Human (sf9, His)

Cat. No.: HY-P73846
Handling Instructions Technical Support

Ku70 is a single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA nonhomologous end joining (NHEJ) and is central to double-strand break repair and V(D)J recombination. As a DNA helicase II complex, it has a cell cycle-dependent preference for double-stranded DNA fork ends in the 3'-5' direction, recognizing and binding to broken DNA ends during NHEJ, protecting them from resection. Ku70-Ku80 Heterodimer Protein, Human (sf9, His) is a recombinant protein dimer complex containing human-derived Ku70-Ku80 Heterodimer protein, expressed by Sf9 insect cells , with N-His labeled tag. Ku70-Ku80 Heterodimer Protein, Human (sf9, His), has molecular weight of ~70 & 85 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ku70 is a single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA nonhomologous end joining (NHEJ) and is central to double-strand break repair and V(D)J recombination. As a DNA helicase II complex, it has a cell cycle-dependent preference for double-stranded DNA fork ends in the 3'-5' direction, recognizing and binding to broken DNA ends during NHEJ, protecting them from resection. Ku70-Ku80 Heterodimer Protein, Human (sf9, His) is a recombinant protein dimer complex containing human-derived Ku70-Ku80 Heterodimer protein, expressed by Sf9 insect cells , with N-His labeled tag. Ku70-Ku80 Heterodimer Protein, Human (sf9, His), has molecular weight of ~70 & 85 kDa, respectively.

Background

The Ku70 is a single-stranded DNA-dependent ATP-dependent helicase crucial for DNA non-homologous end joining (NHEJ), playing a central role in double-strand break repair and V(D)J recombination. Functioning as a DNA helicase II complex, it exhibits a cell cycle-dependent preference for fork-like ends of double-stranded DNA and operates in the 3'-5' direction. During NHEJ, the heterodimer recognizes and binds to broken DNA ends, protecting them from further resection. It acts as a regulatory subunit of the DNA-dependent protein kinase complex (DNA-PK), significantly enhancing the catalytic subunit PRKDC's affinity to DNA. The Ku70 is implicated in stabilizing broken DNA ends and bringing them together for the subsequent ligation step in NHEJ. Additionally, it may serve as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), facilitating the elimination of 5' deoxyribose-5-phosphate at abasic sites near double-strand breaks. Beyond its role in DNA repair, the heterodimer participates in the regulation of transcription, osteocalcin expression, and the early steps of ribosome assembly. It also forms complexes involved in the innate immune response and associates with various interacting partners, highlighting its multifaceted functions in cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P13010 (M1-I732)&P12956 (M1-D609)

Gene ID

7520  [NCBI]&2547  [NCBI]

Molecular Construction
N-term
His
XRCC5 (M1-I732)
Accession # P13010
C-term
N-term
His
XRCC6 (M1-D609)
Accession # P12956
C-term
Protein Length

Full Length

Synonyms
XRCC5-XRCC6 Heterodimer Protein; X-ray repair cross-complementing protein
AA Sequence

MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

Predicted Molecular Mass
157 kDa
Molecular Weight

Approximately 70 kDa (XRCC5) & 85 kDa (XRCC6) , based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Ku70-Ku80 Heterodimer Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ku70-Ku80 Heterodimer Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ku70-Ku80 Heterodimer Protein, Human (sf9, His)
Cat. No.:
HY-P73846
Quantity:
MCE Japan Authorized Agent: