Ku70-Ku80 Heterodimer Protein, Human (sf9, His)
Based on 1 Customer Validation
Ku70 is a single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA nonhomologous end joining (NHEJ) and is central to double-strand break repair and V(D)J recombination. As a DNA helicase II complex, it has a cell cycle-dependent preference for double-stranded DNA fork ends in the 3'-5' direction, recognizing and binding to broken DNA ends during NHEJ, protecting them from resection. Ku70-Ku80 Heterodimer Protein, Human (sf9, His) is a recombinant protein dimer complex containing human-derived Ku70-Ku80 Heterodimer protein, expressed by Sf9 insect cells , with N-His labeled tag. Ku70-Ku80 Heterodimer Protein, Human (sf9, His), has molecular weight of ~70 & 85 kDa, respectively.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ku70 is a single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA nonhomologous end joining (NHEJ) and is central to double-strand break repair and V(D)J recombination. As a DNA helicase II complex, it has a cell cycle-dependent preference for double-stranded DNA fork ends in the 3'-5' direction, recognizing and binding to broken DNA ends during NHEJ, protecting them from resection. Ku70-Ku80 Heterodimer Protein, Human (sf9, His) is a recombinant protein dimer complex containing human-derived Ku70-Ku80 Heterodimer protein, expressed by Sf9 insect cells , with N-His labeled tag. Ku70-Ku80 Heterodimer Protein, Human (sf9, His), has molecular weight of ~70 & 85 kDa, respectively.
Background
The Ku70 is a single-stranded DNA-dependent ATP-dependent helicase crucial for DNA non-homologous end joining (NHEJ), playing a central role in double-strand break repair and V(D)J recombination. Functioning as a DNA helicase II complex, it exhibits a cell cycle-dependent preference for fork-like ends of double-stranded DNA and operates in the 3'-5' direction. During NHEJ, the heterodimer recognizes and binds to broken DNA ends, protecting them from further resection. It acts as a regulatory subunit of the DNA-dependent protein kinase complex (DNA-PK), significantly enhancing the catalytic subunit PRKDC's affinity to DNA. The Ku70 is implicated in stabilizing broken DNA ends and bringing them together for the subsequent ligation step in NHEJ. Additionally, it may serve as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), facilitating the elimination of 5' deoxyribose-5-phosphate at abasic sites near double-strand breaks. Beyond its role in DNA repair, the heterodimer participates in the regulation of transcription, osteocalcin expression, and the early steps of ribosome assembly. It also forms complexes involved in the innate immune response and associates with various interacting partners, highlighting its multifaceted functions in cellular processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Molecular Construction
-
N-term
-
His
-
XRCC5 (M1-I732)
Accession # P13010 -
C-term
-
N-term
-
His
-
XRCC6 (M1-D609)
Accession # P12956 -
C-term
-
-
Synonyms
XRCC5; 86 KDa Subunit Of Ku Antigen; X-Ray Repair Cross Complementing 5; Thyroid-Lupus Autoantigen; Ku86; DNA Repair Protein Ku80; X-Ray Repair Cross-Complementing Protein 5; Ku Autoantigen, 80kDa; CTC Box-Binding Factor 85 KDa Subunit; CTC85; DNA Repair
-
AA Sequence
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
-
Predicted Molecular Mass
157 kDa
-
Molecular Weight
Approximately 70 kDa (XRCC5) & 85 kDa (XRCC6), based on SDS-PAGE under reducing conditions.
-
Structure/Form
Heterodimer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (243 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
