LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation[1][2]. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.

Background

LAG-3 Protein serves as an inhibitory receptor for antigen-activated T cells and transmits inhibitory signals after binding to ligands such as FGL1, which is a major contributor to the inhibitory function of LAG3 T cells[1][2]. Upon T cell receptor (TCR) engagement, LAG-3 Protein binds to CD3-TCR in the immune synapse and directly blocks T cell activation. LAG-3 Protein may cooperate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1 and inhibiting antigen-specific T cell activation[3]. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of CD8(+) and CD4(+) T cells. Furthermore, LAG-3 Protein plays a key role in immune tolerance and is constitutively expressed on a subset of regulatory T cells (Tregs), contributing to their suppressive function[4]. LAG-3 Protein acts as a negative regulator of plasmacytoid dendritic cell (pDC) activation and exhibits interaction with MHC class II (MHC-II), although the exact role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APCs), potentially promoting APC activation/maturation and driving Th1 immune responses.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Conjugation

    Biotin

  • Synonyms

    LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC

  • AA Sequence

    APVKPPQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAXAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGH

  • Predicted Molecular Mass

    50.2 kDa

  • Molecular Weight

    Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00