1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins
  4. LAG-3/CD223
  5. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78848
Instrucciones de manejo Technical Support

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
25 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation[1][2]. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.

Background

LAG-3 Protein serves as an inhibitory receptor for antigen-activated T cells and transmits inhibitory signals after binding to ligands such as FGL1, which is a major contributor to the inhibitory function of LAG3 T cells[1][2]. Upon T cell receptor (TCR) engagement, LAG-3 Protein binds to CD3-TCR in the immune synapse and directly blocks T cell activation. LAG-3 Protein may cooperate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1 and inhibiting antigen-specific T cell activation[3]. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of CD8(+) and CD4(+) T cells. Furthermore, LAG-3 Protein plays a key role in immune tolerance and is constitutively expressed on a subset of regulatory T cells (Tregs), contributing to their suppressive function[4]. LAG-3 Protein acts as a negative regulator of plasmacytoid dendritic cell (pDC) activation and exhibits interaction with MHC class II (MHC-II), although the exact role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APCs), potentially promoting APC activation/maturation and driving Th1 immune responses.

Actividad biológica

Immobilized Biotinylated Cynomolgus LAG-3 His-Avi at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Monoclonal Anti-Human LAG3 Antibody Human IgG1 with a linear range of 0.2-2 ng/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-His

Accession

XP_005570011.1 (A18-H449)

Gene ID

102122272

Conjugation

Biotin

Synonyms
LAG3; CD223; FDC
AA Sequence

APVKPPQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAXAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGH

Peso molecular

60-80 kDa

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78848
Cantidad:
MCE Japan Authorized Agent: