LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation[1][2]. LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of LAG-3 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 432 a.a., with molecular weight of 60-80 kDa.
Background
LAG-3 Protein serves as an inhibitory receptor for antigen-activated T cells and transmits inhibitory signals after binding to ligands such as FGL1, which is a major contributor to the inhibitory function of LAG3 T cells[1][2]. Upon T cell receptor (TCR) engagement, LAG-3 Protein binds to CD3-TCR in the immune synapse and directly blocks T cell activation. LAG-3 Protein may cooperate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1 and inhibiting antigen-specific T cell activation[3]. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of CD8(+) and CD4(+) T cells. Furthermore, LAG-3 Protein plays a key role in immune tolerance and is constitutively expressed on a subset of regulatory T cells (Tregs), contributing to their suppressive function[4]. LAG-3 Protein acts as a negative regulator of plasmacytoid dendritic cell (pDC) activation and exhibits interaction with MHC class II (MHC-II), although the exact role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APCs), potentially promoting APC activation/maturation and driving Th1 immune responses.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
XP_005570011.1 (A18-H449)
-
Gene ID102122272
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC
-
AA Sequence
APVKPPQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAXAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGH
-
Predicted Molecular Mass
50.2 kDa
-
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Luisa Chocarro, et al. Understanding LAG-3 Signaling. Int J Mol Sci. 2021 May; 22(10): 5282.
[2]. Jun Wang, et al. Fibrinogen-like Protein 1 Is a Major Immune Inhibitory Ligand of LAG-3. Cell. 2019 Jan 10;176(1-2):334-347.e12. [Content Brief]
[4]. Smadar Gertel, et al. Lymphocyte activation gene-3 (LAG-3) regulatory T cells: An evolving biomarker for treatment response in autoimmune diseases. Autoimmun Rev. 2022 Jun;21(6):103085. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)