LAG-3 Protein, Marmoset (HEK293, His)
Based on 1 Customer Validation
LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Marmoset
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.
Background
LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.
Verified Bioactivity
Immobilized Madarex LAG-3 MAb Human IgG1 at 2 μg/mL (100 μL/well) can bind Marmoset LAG-3 His with a linear range of 10-237 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Marmoset
-
Source HEK293
-
Tag C-10*His
-
Accession
XP_002752325.1 (A18-H449)
-
Gene ID100415501 [NCBI]
-
Molecular Construction
-
N-term
-
LAG-3 (A18-H449)
Accession # XP_002752325.1 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC
-
AA Sequence
APVKPPQPGAEVSEVWAQEGAPAQLPCSPTIPLQDLSLLRRGGVTWQHQPDSGPPAPVPGHPPAPGPRAAAPSSSRPGPRRYTVLSVAPGGLRSGRLPLQPRVQLEERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRTLSCHLRLRVGQASMTASPAGSLRTSDWVILNCSFSRPDRPASVQWFRGGGQGRVPVQESPHHHLAESFLFLPQVSLMDSGPWGCTLTYRDGFSVSIVYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPPGVGTQPFLTAKWAPPGGGPDLLVPGDNGNFTLQLEDVSQAQAGTYTCHICLQGQQLSATVTLAVITVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDAPSQRSFPGPWLEAQDAQLLSQPWQCQLYQGERLLGAAVYFTALSSPGAQRSGRAPGALHAGH
-
Predicted Molecular Mass
46.1 kDa
-
Molecular Weight
Approximately 57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)