LAG-3 Protein, Marmoset (HEK293, His)

Customer Review

Based on 1 Customer Validation

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Marmoset
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.

Verified Bioactivity

Immobilized Madarex LAG-3 MAb Human IgG1 at 2 μg/mL (100 μL/well) can bind Marmoset LAG-3 His with a linear range of 10-237 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Madarex LAG-3 MAb, Human IgG1 at 2 μg/mL (100 μL/well) can bind Marmoset LAG-3, The ED50 for this effect is 236.8 ng/mL.

Technical Parameters

  • Species Marmoset
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LAG-3 (A18-H449)
      Accession # XP_002752325.1
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC

  • AA Sequence

    APVKPPQPGAEVSEVWAQEGAPAQLPCSPTIPLQDLSLLRRGGVTWQHQPDSGPPAPVPGHPPAPGPRAAAPSSSRPGPRRYTVLSVAPGGLRSGRLPLQPRVQLEERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRTLSCHLRLRVGQASMTASPAGSLRTSDWVILNCSFSRPDRPASVQWFRGGGQGRVPVQESPHHHLAESFLFLPQVSLMDSGPWGCTLTYRDGFSVSIVYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPPGVGTQPFLTAKWAPPGGGPDLLVPGDNGNFTLQLEDVSQAQAGTYTCHICLQGQQLSATVTLAVITVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDAPSQRSFPGPWLEAQDAQLLSQPWQCQLYQGERLLGAAVYFTALSSPGAQRSGRAPGALHAGH

  • Predicted Molecular Mass

    46.1 kDa

  • Molecular Weight

    Approximately 57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00