LAMP5 Protein, Cynomolgus (HEK293, His)
LAMP5 belongs to the LAMP (lysosome-associated membrane protein) family, which consists of multiple members. LAMP5 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LAMP5 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LAMP5 belongs to the LAMP (lysosome-associated membrane protein) family, which consists of multiple members. LAMP5 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LAMP5 protein, expressed by HEK293 , with C-His labeled tag.
Background
I apologize, but as of my knowledge cutoff date in January 2022, there is limited information available about LAMP5 protein. The LAMP (lysosome-associated membrane protein) family consists of several members, but LAMP5 specifically is not extensively characterized in the literature. Therefore, I cannot provide a detailed description of LAMP5 protein's functions, expression patterns, or roles in cellular processes. It is possible that more research has been conducted on LAMP5 since then, so I would recommend consulting more recent scientific literature or databases for up-to-date information on LAMP5 protein.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
G7PGY6 (E30-E235)
-
Molecular Construction
-
N-term
-
LAMP5 (E30-E235)
Accession # G7PGY6 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LAMP5; DJ1119D9.3; Prev. C20orf103; Lysosomal-Associated Membrane Protein Family, Member 5; BAD-LAMP; Brain And Dendritic Cell Associated LAMP; Lysosomal Associated Membrane Protein Family Member 5; Lysosome-Associated Membrane Protein 5; UNC-46; Chromoso
-
AA Sequence
EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSESELQVFWVDRAYALKMLFVKESHNTSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKMVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEE
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
