LAMP5 Protein, Cynomolgus (HEK293, His)

LAMP5 belongs to the LAMP (lysosome-associated membrane protein) family, which consists of multiple members. LAMP5 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LAMP5 protein, expressed by HEK293 , with C-His labeled tag.

I apologize, but as of my knowledge cutoff date in January 2022, there is limited information available about LAMP5 protein. The LAMP (lysosome-associated membrane protein) family consists of several members, but LAMP5 specifically is not extensively characterized in the literature. Therefore, I cannot provide a detailed description of LAMP5 protein's functions, expression patterns, or roles in cellular processes. It is possible that more research has been conducted on LAMP5 since then, so I would recommend consulting more recent scientific literature or databases for up-to-date information on LAMP5 protein.

Cynomolgus

HEK293

C-8*His

G7PGY6 (E30-E235)

102137452  [NCBI]

Partial

EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSESELQVFWVDRAYALKMLFVKESHNTSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKMVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEE

Approximately 30-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.